KEGG   Ailuropoda melanoleuca (giant panda): 100474867
Entry
100474867         CDS       T01329                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04024  cAMP signaling pathway
aml04210  Apoptosis
aml04380  Osteoclast differentiation
aml04620  Toll-like receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04668  TNF signaling pathway
aml04713  Circadian entrainment
aml04725  Cholinergic synapse
aml04728  Dopaminergic synapse
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04921  Oxytocin signaling pathway
aml04926  Relaxin signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml04932  Non-alcoholic fatty liver disease
aml04935  Growth hormone synthesis, secretion and action
aml05031  Amphetamine addiction
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05161  Hepatitis B
aml05162  Measles
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05224  Breast cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05323  Rheumatoid arthritis
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100474867 (FOS)
   04668 TNF signaling pathway
    100474867 (FOS)
   04024 cAMP signaling pathway
    100474867 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100474867 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100474867 (FOS)
   04660 T cell receptor signaling pathway
    100474867 (FOS)
   04658 Th1 and Th2 cell differentiation
    100474867 (FOS)
   04659 Th17 cell differentiation
    100474867 (FOS)
   04657 IL-17 signaling pathway
    100474867 (FOS)
   04662 B cell receptor signaling pathway
    100474867 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100474867 (FOS)
   04917 Prolactin signaling pathway
    100474867 (FOS)
   04921 Oxytocin signaling pathway
    100474867 (FOS)
   04926 Relaxin signaling pathway
    100474867 (FOS)
   04935 Growth hormone synthesis, secretion and action
    100474867 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    100474867 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    100474867 (FOS)
   04728 Dopaminergic synapse
    100474867 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100474867 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100474867 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100474867 (FOS)
   05231 Choline metabolism in cancer
    100474867 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100474867 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100474867 (FOS)
   05224 Breast cancer
    100474867 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100474867 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    100474867 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100474867 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100474867 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100474867 (FOS)
   05135 Yersinia infection
    100474867 (FOS)
   05133 Pertussis
    100474867 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100474867 (FOS)
   05170 Human immunodeficiency virus 1 infection
    100474867 (FOS)
   05161 Hepatitis B
    100474867 (FOS)
   05171 Coronavirus disease - COVID-19
    100474867 (FOS)
   05162 Measles
    100474867 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100474867 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100474867 (FOS)
   05142 Chagas disease
    100474867 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100474867 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100474867 (FOS)
   04131 Membrane trafficking [BR:aml04131]
    100474867 (FOS)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100474867 (FOS)
Membrane trafficking [BR:aml04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100474867 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 100474867
NCBI-ProteinID: XP_002914750
Ensembl: ENSAMEG00000018335
UniProt: D2GZY0
LinkDB
Position
14
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT
LPLLSDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc
tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg
ggctctcccgtcaatgcgcaggacttctgcacggatctggccgtctccagtgccaacttc
atcccgacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc
ctggtctcctccgtggccccctcccagaccagagccccccacccctatggagtccctacc
ccctccgctggggcttactccagggctggagtcgtgaagaccatgacgggaggcagagct
cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggccgcagccaagtgccggaaccggaggagggag
ctgactgacactctccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcggctcac
cgacctgcctgcaagatccccgacgacctgggcttccccgaagagatgtctgtggcttcc
ctagatctgagcgggggcctgcccgaagccgccacccccgagtccgaggaggctttcacc
ctgcccctcctcagtgatcctgagcccaagccctccgtggagcccgtcaagagcatcagc
agcatggagctgaaggccgagccctttgatgacttcctgttcccagcgtcatccaggccc
agcggctccgagaccgcccgctccgtgccagacatggacctgtctggttccttctatgca
gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg
gagcctctgtgcacccccgtggtcacctgtactcccagctgcactacctacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgctcaccgcaag
ggcagcagcagcaacgaaccgtcctctgactcgctcagctcccccacgctgctggccctg
tga

DBGET integrated database retrieval system