KEGG   Ailuropoda melanoleuca (giant panda): 100475429
Entry
100475429         CDS       T01329                                 

Gene name
MMP9
Definition
(RefSeq) matrix metalloproteinase-9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04657  IL-17 signaling pathway
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04915  Estrogen signaling pathway
aml04926  Relaxin signaling pathway
aml05161  Hepatitis B
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05215  Prostate cancer
aml05219  Bladder cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100475429 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100475429 (MMP9)
   04670 Leukocyte transendothelial migration
    100475429 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100475429 (MMP9)
   04926 Relaxin signaling pathway
    100475429 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475429 (MMP9)
   05202 Transcriptional misregulation in cancer
    100475429 (MMP9)
   05206 MicroRNAs in cancer
    100475429 (MMP9)
   05205 Proteoglycans in cancer
    100475429 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    100475429 (MMP9)
   05215 Prostate cancer
    100475429 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100475429 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100475429 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100475429 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aml01002]
    100475429 (MMP9)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     100475429 (MMP9)
Peptidases and inhibitors [BR:aml01002]
 Metallo peptidases
  Family M10
   100475429 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PT PG_binding_1 Reprolysin_4 DUF4953 Reprolysin_3 Peptidase_M66
Other DBs
NCBI-GeneID: 100475429
NCBI-ProteinID: XP_002928103
Ensembl: ENSAMEG00000012773
UniProt: D2HZ16
LinkDB
Position
13
AA seq 704 aa
MSPRQPLVLVLLVLGCCSAAPRPHKPTLVVFPGDLRANLTDKQLAEEYLFRYGYTKVAEM
NEDKQSLSRTLRLLQRRLALPETGELDKTTLDAMRAPRCGVPDLGRFQTFEGDLKWHHRD
ITYWIQNYSDDLPRNVIDDAFARAFALWSAVTPLTFTRVYGPEADIVIQFGVREHGDGYP
FDGKDGLLAHAFPPGQGIQGDAHFDDEELWSLGKGVVVPTYFGNSDGAPCHFPFTFEGRS
YSACTTDGRSDDMAWCSTTADYDTDRRFGFCPSERLYTQDGNGDGKPCVFPFTFEGKSYS
SCTTEGRSDGYRWCATTANYDQDRLYGFCPTRVDSTVTGGNSAGEPCVFPFIFLGKEYST
CTREGRGDGHLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYSFTEGPPLHEDDVKGIQSLYGPRPDPEPQPPTVQPTAQPTGCPTGPPTTRPSERPTT
GPTGPPAAGPTGPPTAGPSEPPTVTFNPAEDICKVNFFDAIAEIGNRLHFFKDGKYWRFS
DGKARRVQGPFLITDSWPALPHKLDSAFEDPLTRKIFFFSGRQVWVYAGASVLGPRRLDK
LGLGPEVAQITGALPQGGAKVLLFSWQRFWRFDVKTQTVDPNSLGSVGRVFPGVPLNSHN
IFQYQGKAHFCQDRFYWRVNSRNDVNQVDEVGYVTYDFLRCPED
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgagccccaggcagcccctggtcctggtgctcctggtgctgggctgctgctctgcggct
cccagaccacacaagcccacccttgtggtcttcccaggagacctgagagctaatctcact
gacaagcagctggcagaggaatatctgtttcgctatggctacacgaaagtggccgagatg
aacgaggacaagcagtctctgagtcggacactgcggcttctccagaggcgcctggctctg
cctgagactggagagctggacaaaaccaccctggacgccatgcgggccccgcgctgtggc
gtcccggacctgggcagattccagacatttgagggcgacctcaagtggcaccaccgggac
atcacttactggatccaaaactactcggatgacttgccgcgcaacgtgatcgacgacgcc
tttgcccgcgcctttgcgctctggagcgcggtgacgccgctcaccttcactcgcgtgtac
ggccctgaagccgacatcgtcattcagtttggtgttagggagcacggagatggatatccc
ttcgatgggaaggacgggctcctggcacacgcctttcctccgggccagggcattcaggga
gacgctcacttcgacgatgaagagttgtggtctctgggcaagggcgtcgtggttccgacc
tacttcggaaactcagatggcgccccctgtcacttccccttcaccttcgagggccgctcc
tactccgcctgcaccacggacggccgctccgacgacatggcctggtgcagcaccacggcc
gactatgacaccgaccgccggttcggcttctgccccagcgagagactctacacccaggac
ggcaatggggacggcaagccctgcgtgtttcccttcaccttcgagggcaaatcttactcc
agctgcaccaccgaaggtcgctcagacggctaccgctggtgcgccaccacagccaactat
gaccaggacagactctatggcttctgccccacccgagtcgactccacggtgaccgggggc
aactccgcgggggagccgtgtgtcttccccttcatcttcctgggcaaggagtactcgacc
tgcaccagggagggccgcggagatgggcacctctggtgtgccaccacctcgaactttgac
agagacaagaagtggggcttctgcccggaccaaggatacagcctgttccttgtggctgcc
catgagtttggccacgcgctgggtttagatcactcatcggtgcccgaagcgctcatgtac
cccatgtacagcttcactgaggggccccccctgcatgaggacgatgtgaagggcatccag
tcgctgtatggtcctcgccctgaccctgaaccacagcctccaacagttcagcccaccgct
caaccaaccggctgccctaccgggcctcccactacccgcccctcagagcgccccactact
ggccccacaggcccccctgcagctggccccacgggtccccccactgctggcccttctgag
ccccctacagtgactttcaacccagcagaggatatatgcaaagtgaacttcttcgatgcc
atcgcggagatcgggaaccgtctgcatttcttcaaggatgggaagtactggcgattctct
gacggcaaggcgcgccgggtgcagggccccttccttatcactgactcgtggcctgcactg
ccccacaagctggactccgcctttgaggacccgctcaccaggaagattttcttcttctct
gggcgccaggtgtgggtgtacgcaggcgcgtcggtgctgggcccaaggcgtctggacaag
cttggcctgggcccggaggtggcccaaatcacaggggccctcccgcaaggcggggctaag
gtgctactgtttagctggcaacgcttctggaggttcgacgtgaagacgcagaccgtcgat
cccaacagcctcggctcggtggggcgggtgttccccggggtgcccctgaactcgcacaac
atcttccagtaccaagggaaagcccacttctgccaggaccgtttctactggcgtgtgaat
tctcggaatgatgtgaaccaggtggacgaagtgggttacgtgacctatgacttcctacgg
tgcccggaggattag

DBGET integrated database retrieval system