KEGG   Ailuropoda melanoleuca (giant panda): 100477714
Entry
100477714         CDS       T01329                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein isoform X1
  KO
K06618  retinoblastoma-associated protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04110  Cell cycle
aml04218  Cellular senescence
aml04934  Cushing syndrome
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05212  Pancreatic cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100477714 (RB1)
   04218 Cellular senescence
    100477714 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477714 (RB1)
   05203 Viral carcinogenesis
    100477714 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100477714 (RB1)
   05225 Hepatocellular carcinoma
    100477714 (RB1)
   05226 Gastric cancer
    100477714 (RB1)
   05214 Glioma
    100477714 (RB1)
   05220 Chronic myeloid leukemia
    100477714 (RB1)
   05218 Melanoma
    100477714 (RB1)
   05219 Bladder cancer
    100477714 (RB1)
   05215 Prostate cancer
    100477714 (RB1)
   05224 Breast cancer
    100477714 (RB1)
   05222 Small cell lung cancer
    100477714 (RB1)
   05223 Non-small cell lung cancer
    100477714 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100477714 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100477714 (RB1)
   05161 Hepatitis B
    100477714 (RB1)
   05160 Hepatitis C
    100477714 (RB1)
   05163 Human cytomegalovirus infection
    100477714 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100477714 (RB1)
   05169 Epstein-Barr virus infection
    100477714 (RB1)
   05165 Human papillomavirus infection
    100477714 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100477714 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100477714 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100477714 (RB1)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100477714 (RB1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    100477714 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 TFIIB
Other DBs
NCBI-GeneID: 100477714
NCBI-ProteinID: XP_034521066
Ensembl: ENSAMEG00000003640
LinkDB
Position
7
AA seq 928 aa
MPPKTPRRAAAAATAAAEPPPPPPPPPAPEEDPEQDSGPDDLPLPRLVFEETEEPDFTAL
CQKLKIPDHVRERAWLTWEKVSSVDGVLEGYVQRKKELWGICIFIAAVDLDEMPFTFTEL
QKNIETSVCKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSSL
ISTEINSVLVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPALLKEPYK
TAVIPFNGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGIVASNGLPEVESLSKQYEEIYLKNKDLDARLFLDHDKTLQADPIDSFEMQRTPRKS
NSDEEVNVILPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
DVGYIFKEKFAKAVGQGCMEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRNTSQNLDTGTDLSFPWILNVLNLKAFDFYKVIESFIKAEA
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGPADHLESACTLNLPLQSNH
TAADMYLSPVRSPKKKGSTIRVNSTANTEAQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGVPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNREEK
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccggagagcagcagccgccgccaccgctgccgccgaacccccg
ccgccgccgccgccgccccccgctcctgaggaggaccccgagcaggacagtggccccgac
gacctgcctctgcccaggcttgtgtttgaagaaaccgaagaacctgattttactgcatta
tgtcagaaattaaagataccagatcatgtcagagaaagagcttggttaacttgggagaaa
gtttcatctgtggatggagtattggaaggttatgttcaaaggaaaaaggagctatgggga
atctgtatctttattgcagcagttgacctagatgagatgccattcacttttactgagcta
cagaaaaacatagaaaccagtgtctgcaaattctttgatttactaaaagaaattgatacc
agtactaaagttgataatgctatgtcaagactgttgaagaagtataatgtattgtgtgca
ctctacagcaaattagaaaggacatgtgaacttatatatttgacacagcccagcagtttg
atatctactgaaattaactctgtgttggtgctaaaagtttcttggatcacgtttttacta
gcgaaaggggaagtgttacaaatggaggatgatctcgtcatctcatttcagttaatgctc
tgtgtccttgactattttattaaactctcacctcctgcattgcttaaagaaccatataaa
acagctgtaataccttttaatggttcacctcgaacaccaaggcgaggtcagaacaggagt
gcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaa
catgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaatttcataccttttatg
aattctcttggaattgtagcttctaatggacttccagaggtggaaagtctctctaaacaa
tatgaagagatttaccttaaaaacaaagatcttgatgcaagattatttctggatcatgat
aaaactcttcaggctgatcctatagacagttttgaaatgcagagaacaccacgaaaaagt
aactctgatgaagaggtgaatgtgattcttccacaaactccagttaggactgttatgaat
actatccaacaattaatgatgatcttaaattcagcaagtgatcaaccatcagaaaatttg
atttcctattttaataactgcacagtgaatccaaaggaaagtatcctgaaaagagtgaag
gatgttggatacatctttaaagagaaatttgctaaagctgtgggacagggatgtatggaa
attggatcacagcgatacaaacttggagtccgattgtattaccgagtaatggaatccatg
cttaaatcagaagaagaacgattatccattcaaaattttagcaaactcctgaatgacaac
atctttcatatgtctttgttggcatgtgcccttgaggttgtaatggctacatatagcaga
aatacatctcagaatcttgatactggaacagatttgtccttcccatggattctgaatgta
cttaatttaaaagcatttgatttttacaaagtgattgaaagttttatcaaagcagaagcc
aacttgaccagagaaatgataaaacatttagaacgatgtgaacatcgaatcatggaatca
cttgcatggctctctgattcacctttatttgatctgattaaacaagcaaaagaccgagaa
ggaccagctgatcaccttgaatctgcttgtactctcaaccttcctctccagagtaatcac
actgcagcggatatgtatctttctcctgtaagatccccaaagaaaaaaggatcaactata
cgtgtaaattctactgcaaacacagaggcacaagcaacctcagccttccagactcagaag
ccattgaaatctacctccctttcacttttttacaaaaaagtgtaccgactagcatatctt
cgactaaataccctgtgtgcacgccttctgtctgaccacccagaactagaacacatcatc
tggaccctttttcagcacacactgcaaaatgagtatgaactcatgagggacaggcatttg
gatcagattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaa
ttcaaaatcattgtaacagcatacaaggatcttcctcatgctgttcaggagacattcaaa
cgtgttttgatcagagaagaggagtatgattccattatagtattctataactcggtcttc
atgcagagactgaaaacaaatattttgcagtatgcttctaccaggccccctaccttgtca
ccaatacctcacattcctcgaagcccttacaagttttctagttcacctttacggattcct
ggggggaacatctatatatcacccctgaagaatccatataaaatttcagaaggtgtgcca
acgccaacaaaaatgactccaagatcaagaatcttagtatcaattggtgaatcatttggg
acttctgagaagttccagaaaataaaccagatggtgtgtaacagcgaccgtgtgctcaaa
agaagtgctgaaggcagcaaccctcccaaaccattgaaaaaactacgctttgatattgaa
ggatcagatgaagcagatggaagtaaacatctcccaggggagtccaaatttcaacagaaa
ctggcagaaatgacatctacccgaacacgaatgcagaagcaaaaaatgaacgatagcatg
gatacctcaaacagggaagaaaaatga

DBGET integrated database retrieval system