KEGG   Ailuropoda melanoleuca (giant panda): 100479481
Entry
100479481         CDS       T01329                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04120  Ubiquitin mediated proteolysis
aml04144  Endocytosis
aml04151  PI3K-Akt signaling pathway
aml04218  Cellular senescence
aml04625  C-type lectin receptor signaling pathway
aml04919  Thyroid hormone signaling pathway
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100479481 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100479481 (MDM2)
   04151 PI3K-Akt signaling pathway
    100479481 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100479481 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    100479481 (MDM2)
   04115 p53 signaling pathway
    100479481 (MDM2)
   04218 Cellular senescence
    100479481 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100479481 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100479481 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479481 (MDM2)
   05202 Transcriptional misregulation in cancer
    100479481 (MDM2)
   05206 MicroRNAs in cancer
    100479481 (MDM2)
   05205 Proteoglycans in cancer
    100479481 (MDM2)
   05203 Viral carcinogenesis
    100479481 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    100479481 (MDM2)
   05220 Chronic myeloid leukemia
    100479481 (MDM2)
   05218 Melanoma
    100479481 (MDM2)
   05219 Bladder cancer
    100479481 (MDM2)
   05215 Prostate cancer
    100479481 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100479481 (MDM2)
   05169 Epstein-Barr virus infection
    100479481 (MDM2)
   05165 Human papillomavirus infection
    100479481 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100479481 (MDM2)
   01522 Endocrine resistance
    100479481 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100479481 (MDM2)
   04121 Ubiquitin system [BR:aml04121]
    100479481 (MDM2)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100479481 (MDM2)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100479481 (MDM2)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100479481 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP
Other DBs
NCBI-GeneID: 100479481
NCBI-ProteinID: XP_002918363
Ensembl: ENSAMEG00000008526
LinkDB
Position
15
AA seq 487 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQHEPSDSGT
SVSENRCHLEGGSDQKEPVQELQEEKPSSSDLVSRPSTSSRRRAISETEEHSDELPGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKGKIPEKAKLENSTQVEEGFDVPDCKK
TAVNDSRESCAEENDDKITQASQSQESEDYSQPSTSNSIIYSSQEDVKELEREETQDKEE
IVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQM
IVLTYFP
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaggagaccctggttagaccaaagcctttgcttttgaagttgttaaagtct
gttggtgcacaaaaagacacttatactatgaaagaggttatattttatcttggccagtat
attatgactaaacgattatatgatgagaagcaacagcatattgtgtattgttccaatgat
cttctaggggatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcatgaaccttcagattcaggcaca
tctgtgagtgaaaataggtgtcaccttgaaggtgggagtgatcaaaaggagccggtgcaa
gagttgcaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatct
agaaggagagcaattagtgagacagaagaacattcagatgaattacctggtgaacggcag
agaaagcgccacaaatctgatagtatttccctttcctttgatgaaagccttgctctgtgt
gtaataagggagatatgctgtgaaagaagcagtagcagtgaatcaacagggacaccatca
aatccggatcttgatgctggtgtaagtgaacattcaggtgactggttggatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtctctcgattcagaagattacagt
cttagtgaagaaggacaagaactctcagatgaagacgatgaggtatatcgagtaactgtg
tatcaggcaggggagagtgataccgattcatttgaagaagatcctgaaatttccttagct
gactactggaagtgtacttcgtgcaatgaaatgaatcctcctcttccgcctcattgcaac
agatgttgggcccttcgtgagaactggcttcctgaagataaagggaaaatacctgagaaa
gccaaactagaaaactcaacacaagtagaagagggctttgatgtccctgattgtaaaaaa
actgcagtgaatgattccagagaatcatgtgctgaggaaaatgatgataaaatcacacaa
gcctcccaatcccaagaaagtgaggattattctcagccatcaacttctaacagcatcatt
tatagcagccaagaagatgtcaaagagcttgagagggaagaaacacaagacaaagaagaa
attgtggaatctagttttccccttaatgccattgaaccttgtgtgatttgccaaggtcga
cctaaaaacggttgcattgttcatggcaaaacaggacatcttatggcatgctttacatgt
gcaaagaagctcaagaaaaggaataagccctgtccagtatgtagacaaccaattcaaatg
attgtgctaacttatttcccctag

DBGET integrated database retrieval system