KEGG   Ailuropoda melanoleuca (giant panda): 100479715
Entry
100479715         CDS       T01329                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X3
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04260  Cardiac muscle contraction
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04726  Serotonergic synapse
aml04727  GABAergic synapse
aml04728  Dopaminergic synapse
aml04742  Taste transduction
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04921  Oxytocin signaling pathway
aml04924  Renin secretion
aml04925  Aldosterone synthesis and secretion
aml04927  Cortisol synthesis and secretion
aml04929  GnRH secretion
aml04930  Type II diabetes mellitus
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05410  Hypertrophic cardiomyopathy
aml05412  Arrhythmogenic right ventricular cardiomyopathy
aml05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100479715 (CACNA1C)
   04020 Calcium signaling pathway
    100479715 (CACNA1C)
   04024 cAMP signaling pathway
    100479715 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    100479715 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100479715 (CACNA1C)
   04929 GnRH secretion
    100479715 (CACNA1C)
   04912 GnRH signaling pathway
    100479715 (CACNA1C)
   04921 Oxytocin signaling pathway
    100479715 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    100479715 (CACNA1C)
   04924 Renin secretion
    100479715 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    100479715 (CACNA1C)
   04927 Cortisol synthesis and secretion
    100479715 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100479715 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    100479715 (CACNA1C)
   04270 Vascular smooth muscle contraction
    100479715 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100479715 (CACNA1C)
   04727 GABAergic synapse
    100479715 (CACNA1C)
   04725 Cholinergic synapse
    100479715 (CACNA1C)
   04728 Dopaminergic synapse
    100479715 (CACNA1C)
   04726 Serotonergic synapse
    100479715 (CACNA1C)
   04720 Long-term potentiation
    100479715 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    100479715 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    100479715 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100479715 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100479715 (CACNA1C)
   05020 Prion disease
    100479715 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    100479715 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    100479715 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100479715 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100479715 (CACNA1C)
   05414 Dilated cardiomyopathy
    100479715 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100479715 (CACNA1C)
   04934 Cushing syndrome
    100479715 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aml04040]
    100479715 (CACNA1C)
Ion channels [BR:aml04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100479715 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 100479715
NCBI-ProteinID: XP_019649003
Ensembl: ENSAMEG00000004027
LinkDB
Position
16
AA seq 2188 aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEVVEKPAVEETKEEKIELKSITADGESPPTTKINMDDLQPNENEDKCPYPNP
ENTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNADYVF
TSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVL
RVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSD
SSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPEL
LYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNC
ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQH
YGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVIL
SETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFR
VMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTE
INRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFA
VFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRI
KTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFK
KRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASE
DDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAANSQGDTESPSHEKLVDST
FTPSSYSSTGSNANINNANNTALGRFPRPAGYPSAVSTVEGHGPPLSPAVRVQEAAWKLS
SKRCHSRESQIAMVCQEEVSQDKTYDVKMSEDTEYCSEPSLISTEMLSHQDDENRQLTPP
EEDKRDVRQSPKRGFLRSASLGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAV
AGLSPLLQRSHSPSTFPRPCATPPATPGSRGWPPQPIPTLRLEGAESSEKLNSSFPSIHC
SSWSGEPTPCDAGSSAIRRARPVSLTVPSQAGARGRQFHGSASSLVEAVLISEGLGQFAQ
DPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDRAGGQ
EGETCTTAPVCRKSEEELQDSRAHAGGL
NT seq 6567 nt   +upstreamnt  +downstreamnt
atggtcaatgagaacacgaggatgtacattccagaggaaaatcatcaaggttctaactat
gggagtccgcgcccagctcatgccaacatgaatgccaatgccgccgcggggctcgcccct
gagcacatccctacgccgggggcggccctgtcctggcaggcggccatcgacgcggcccgg
caggccaagctgatgggcagcgccggcaacgcgaccatctccacggtcagctccacgcag
cggaagcggcagcagtacgggaaacccaagaagcagggcagcacgactgccacgcgcccg
ccccgcgccctgctctgcctgactctgaagaaccccatccggagggcgtgcatcagcatc
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagcgatctatattccctttccagaagacgactccaacgccaccaattccaacctggaa
cgagtggaatatctctttctcataatttttactgtggaagcatttttaaaagtaatagcc
tatggacttctctttcaccccaacgcttacctccgcaatggttggaatttactagatttt
ataattgtggttgtagggctttttagtgcaattttagaacaagcaaccaaagccgacggg
gcaaatgctctgggagggaaaggagctggatttgacgtgaaggcactgagggcattccgt
gtgctgcgccccttgcgcctggtatctggagtcccaagtctccaggtggttctgaattcc
attatcaaggccatggtgcccctgctgcatattgctctgttagtgctgtttgtaatcatc
atctatgccatcattggcctggagctcttcatggggaagatgcataagacctgctacaac
caggaaggcatagcagatgttccagcagaagatgatccttccccttgtgctctggagaca
ggccatgggcgtcagtgtcagaacggcactgtgtgcaagcctgggtgggacgggcccaag
cacggcatcaccaacttcgacaattttgccttcgccatgttgacagtgttccagtgcatc
accatggagggctggacagacgtcctgtactgggtcaatgatgccgtaggaagggactgg
ccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttggtt
ctcggtgttcttagcggagagttctccaaagagagggagaaggccaaggctcggggagat
ttccagaaacttcgagagaagcagcagctggaagaggatctgaagggctacctggactgg
atcacccaggcagaggacattgaccctgagaatgaggatgaaggcatggatgaggagaag
ccccgaaacatgagtatgcccacaagcgagaccgagtctgtcaacactgaaaacgtggct
ggaggtgacatcgagggagagaactgcggggccaggctggcccaccggatttccaaatca
aagttcagccgctactggcgccgctggaatcggttctgcagaagaaagtgtcgtgccgca
gtcaagtctaatgtcttctactggcttgtgatcttcctggtgttcctcaacactctcacc
attgcctcggaacactacaaccagccccactggctcacggaggtgcaagacacggccaac
aaggcgctactggcccttttcactgcggagatgctgctgaagatgtacagcctgggcctg
caggcctacttcgtgtccctcttcaaccgcttcgactgtttcatcgtgtgtggtggcatc
ctggagaccatcctggtggagaccaagatcatgtctcccttgggcatctctgtgttgaga
tgtgtccggctactgcggatatttaaaatcacaaggtactggaactctttaagcaacctg
gtggcatccttgctgaattctgtgcgctccattgcctccctactgctgctcctcttcctc
ttcatcatcatcttctccctcctggggatgcagctctttggaggaaagttcaactttgat
gaaatgcagacccggaggagcacatttgataactttccccagtccctcctcaccgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aactatatcctactgaatgtgttcttggccattgctgtggacaacctggctgatgctgag
agcctcacatctgcccaaaaggaggaagaagaagagaaggaaagaaagaagctggccagg
actgccagcccagagaagaaacaagaggtggtggagaagccagcagtggaggagaccaag
gaggagaaaattgaactgaaatccattacagctgatggagagtccccacccaccaccaag
atcaacatggatgacctccagcccaatgaaaatgaggataagtgtccctaccccaaccca
gaaaatacaggagaagaggatgaggaggagcctgagatgcctgtgggcccccggccacga
ccactctctgagctgcaccttaaggaaaaggcagtgcccatgccagaagccagtgcgttt
ttcatcttcagccccaacaacagatttcgcctccagtgtcaccgcattgtcaatgacacg
atcttcaccaacctgatcctcttcttcattctgctcagcagcatttccctggcagctgag
gaccccgtccagcacacctccttcaggaaccatattctgttttattttgacattgttttc
actaccattttcaccattgaaattgctctgaagatcctaggcaatgcagactatgtcttc
actagtatctttacattagaaattatccttaagatgactgcatatggggctttcctacac
aagggctctttttgccgaaactacttcaacatcttggacctgctggtggtcagcgtgtcc
ctcatttcctttggcatccagtcaagtgcaatcaacgtggtgaagatcttacgagtccta
cgagtcctcaggcccctaagggccatcaacagggccaaggggctgaagcacgtggttcag
tgtgtgttcgtcgccatccggaccatcgggaacattgtgattgtcaccacgctacttcag
ttcatgttcgcctgcattggggtccagcttttcaagggaaagctctacacctgctcagat
agctccaaacagactgaggcggaatgcaagggtaactacatcacgtacaaggacggggag
gtcgaccaccccatcatccaaccccgcagctgggagaacagcaagtttgactttgacaat
gttctggcagccatgatggccctctttaccgtctctacctttgaggggtggccagagctg
ctgtaccgctccatcgactcccacacagaagacaagggccccatctacaactaccgtgtg
gagatctccatctttttcatcatctacatcatcatcattgccttcttcatgatgaacatc
ttcgtgggtttcgtcatcgtcaccttccaggagcagggggagcaggaatacaagaactgt
gagctggacaagaaccagcgacagtgcgtggaatatgccctgaaggcccggcccctacgg
aggtacatccccaagaaccagcaccagtacaaagtgtggtacgtggtcaactccacctac
tttgaatacctgatgttcgtcctcatcctgctcaacaccatctgcttggccatgcagcac
tatggccagagctgcctcttcaaaattgccatgaacatcctcaacatgctcttcactggc
ctcttcaccgtggagatgattctgaagctcattgccttcaaacccaagggttactttagt
gatccctggaatgtttttgacttcctcatcgtaattggcagcataattgacgtcattctc
agtgaaactaatcactatttctgtgatgcatggaatacatttgacgccttgattgttgtg
ggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacatacccaatgctct
ccctttatgaacgcagaggagaactcccgcatctccatcaccttcttccgcctcttccgg
gtcatgcgcctggtcaagctgctgagccgcggagaaggcatccggaccctgctgtggacc
ttcatcaagtccttccaggccctgccctatgtggcccttctgatagtgatgctgttcttc
atctacgcggtgattgggatgcaggtgtttggaaaaattgccctgaatgacaccacagag
atcaaccggaacaacaacttccagaccttcccccaagctgtgctgcttctcttcaggtgt
gccacaggggaggcatggcaggacatcatgctggcctgcatgccagggaagaagtgtgcc
cccgaatcggagcccagcaacagcacagaaggcgaaacaccctgtggcagcagcttcgca
gtcttctatttcatcagcttctacatgctttgtgccttcctgatcatcaacctctttgta
gctgtcatcatggacaactttgactacctgacaagggactggtcaattcttggtccccat
catctggatgaatttaaaagaatctgggcagagtatgatcctgaagccaagggtcgtatc
aaacacctagatgtggtgaccctgcttcgacggatccagcccccactgggttttgggaag
ctgtgccctcaccgcgtggcttgcaaacgcctggtctccatgaacatgcctctgaacagt
gatgggacagtcatgttcaatgccaccctgtttgccctggtccggacagccctgcggatc
aaaacagaagggaacctagaacaagccaatgaggagctgcgggccataatcaagaagata
tggaagcggaccagcatgaagctgttggaccaagtggtgcccccagcaggtgatgacgag
gtcacagttggcaagttttatgctactttcctgatccaagagtatttccggaaattcaag
aagcgcaaagagcagggcctagtgggcaagccctcccagaggaacgccctgtccctacag
gctggcttgcgcacgctgcatgacatcgggcctgagatccgacgggccatctctggggac
ctgacggctgaggaggagctggacaaggccatgaaggaggctgtgtctgctgcctccgaa
gacgacatcttcaggagggccggtggcctgttcggcaaccacgtcagctactaccaaagc
gacggccggagcgccttcccccagaccttcaccacccagcgcccactgcacatcaacaag
gcggctaacagccaaggcgacaccgagtcgccatcccacgagaaactggtggactccact
ttcacccccagcagctactcgtccactggctccaacgccaacatcaacaatgccaacaac
actgccctgggccgcttcccccgccccgctggttaccccagcgcggtcagcaccgtggag
ggccatgggccccccttgtctcctgccgtccgggtgcaggaggcagcatggaagctcagc
tccaagaggtgccactcccgggagagccagatagccatggtgtgtcaggaggaggtctct
caggacaagacctatgacgtgaagatgagcgaagacaccgagtactgcagcgagcccagc
ctgatctccacagagatgctctcccaccaggatgatgaaaatcggcaattaacaccacct
gaggaggacaagagagacgtccggcaatctccaaagaggggtttcctccgctctgcctca
ctaggtcgaagggcctccttccacctggaatgtctgaagcgacagaagaatcaaggggga
gacatctctcagaagacagtcctgcccttgcatctggttcaccatcaggcattggcagtg
gcgggcctgagccccctcctccagagaagccattcccccagcacgttccccaggccatgc
gccacccccccagccacgccgggcagccgaggctggcccccacagccgatccccaccctg
cggctggagggggccgagtccagcgagaaactcaacagcagcttcccgtccatccactgc
agctcttggtccggggagcccacgccctgcgatgcgggcagcagtgccatccggagagcc
cggccggtgtccctcactgtgcccagccaggctggggcccggggcaggcagttccacggc
agcgccagcagcctggtggaagcggtcttgatttcagaaggactggggcagtttgctcaa
gatcccaagtttatcgaggtcacaacccaggagctggctgacgcctgtgacatgaccata
gaggagatggagaacgccgccgacaacatcctcagtgggggcgcccagcagagccccaac
ggcaccctactaccttttgttaactgcagggacccagggcaggacagagcggggggccaa
gagggcgagacctgcaccacggctccggtgtgtcggaaaagcgaggaggagctccaggac
agcagagcccacgccggcggcctgtag

DBGET integrated database retrieval system