KEGG   Ailuropoda melanoleuca (giant panda): 100480891
Entry
100480891         CDS       T01329                                 

Gene name
BRCA1
Definition
(RefSeq) breast cancer type 1 susceptibility protein isoform X5
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml03440  Homologous recombination
aml03460  Fanconi anemia pathway
aml04120  Ubiquitin mediated proteolysis
aml04151  PI3K-Akt signaling pathway
aml05206  MicroRNAs in cancer
aml05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100480891 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    100480891 (BRCA1)
   03460 Fanconi anemia pathway
    100480891 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100480891 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100480891 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    100480891 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100480891 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100480891 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aml04121]
    100480891 (BRCA1)
   03036 Chromosome and associated proteins [BR:aml03036]
    100480891 (BRCA1)
   03400 DNA repair and recombination proteins [BR:aml03400]
    100480891 (BRCA1)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100480891 (BRCA1)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100480891 (BRCA1)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100480891 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    100480891 (BRCA1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100480891 (BRCA1)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     100480891 (BRCA1)
    BRCA1-A complex
     100480891 (BRCA1)
    BRCA1-B complex
     100480891 (BRCA1)
    BRCA1-C complex
     100480891 (BRCA1)
    BRCA complex
     100480891 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     100480891 (BRCA1)
SSDB
Motif
Pfam: BRCT BRCT_2
Other DBs
NCBI-GeneID: 100480891
NCBI-ProteinID: XP_019648408
LinkDB
Position
13
AA seq 1843 aa
MDLPADRVEEVQDVLNAMQKILECPICLELIKEPVSTKCDHIFCKSLQESTRFSQLVEEL
LKIIHAFELDTGLQFVNSYNFSKENNSPDHLKEEVSIIQSMGYRNRAKRLRQSEPENPTL
QETSLSVHLSDLGIVRSLRTKQQIQPQNKSVYIELGSDSSEDTVNKASYCSVGDDELLQI
TPQGARAEASLNPAKKAACEISEDITNIEYHQSGNKDLTTTEKHATEKHPEKYQGISVSN
LHVEPCGTNTHASSLQHENSSLLLTKDRMNVEKAEVCNKSKQLGLARSQQSRWAESKETC
NDRQTPSTEKKVLLNADPLHGRKKPRKQKPACSDCPRDSQDVPWITLNSSIQKVNEWFFR
SDEMLTSDDSHDGGSESNTEVAGAVEVPNEVDGYSGSSEKVDLMASDPQDALIRGSERVH
PKSVESNIEDKIFGKTYRRKASLPSHTNEDLIIGVRAIEPQTTRAHPLTNKAKCKRRTTS
GLLPEDFIKKVDLAVVPKTPEKLVEGTNQIARNGHLMNITNNGPENEAKGDYVQNEKNAN
PTESLEKESAFRSKAEPISSSISNMELELNSCCSKASKKNRLRRKSSTRHACALEFVVNR
NPSPPDHSELQIDSCSSSEEMKKQHLDRMPVRHSKTLQLMEGKEPATGARRGSKPGEQIN
KRLASHAFPELNLTSVPGFSANCSSSNKPQEFVNPGLQREEIEESLGRIRVSDSTRDPKE
LLLGGGRGLQTERSVESIHISLVPDTDYGTQDSISLLEADTLRKAKTAPNRRANLCAATE
NPKEPIHGCSKDTRNDTEGFADPLTCEDNHTQETRIAMEESELDTQYLYNTFKVSKRQSF
ALFSNPGDPEKDCAMVCAHSGALRKQSPKVTLEGGQKEENQGKKESEIKHVQAVHATAGF
SAVSQQAKKPGDYAKCSIKGGAKLCPSSPFRGKETELLIANNRGISHNPYHIPPLSPIRS
YVKTLCKKNPSEERFEQHSMSPERAMGNESVIQSTVSTISQNNIRESTLKEVSSSSVNEV
GSSTNEAGSSINEVGSSGENVQAELGRHRGPKVNAMLRLGLMQPEVYKQSPPVSNCKHPE
MKRQGENEGVVLSVNADFSPCLISDNPEQPMGSTHASQVCSETPDDLLNGDKIKGKSSFA
ESDIRERSAVFSKSVQKGAFGRSHLDETHLAQGHQRGARKLESSEENTSSEEEELPCFQH
LLFGKVTNTPSQPTSHNAVATEGLSKKTEENLDSRKNSLSDLSNQGPSAKASQEHYLSEE
ARCSGSLFSSQHSALEDLIVTTNSQDPFLMFDSPSKQVRHQSENLDVLSDKELVSDDDDE
RELGLDEDNHEEQSVDSDLGEAASGYESETSLSEDCSGLSSQSDILTTQQRDTMQDNLIK
LQQEMAELEAVLEQHGSQPSRSSPSLLAGSGAPEDLLNPEQNTSGKAVLTSEKSSDYPIS
QNPESLSADKFQVSLDSSTSKNKEPGTRRSSPSPSRLLDTRWYVHSGPRNLQNRNCPSQK
ELIKVVSVEEQAPTKSEAQEVVEQSLPRPDLEGTPYLESGISLFSDDPESDPSADRAPEP
AHVSSMPTSTSALKLPQFQVEESAKSTAAVHVANTAGYNKREDTVGREKPEVISSVKKIN
GAISMVASGLTPKEFMLVQKFAKKHHIALTNQISEETTHVIMKTDAEFVCERTLKYFLGI
AGGKWVVSYFWVTQSIKERKILDEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEVC
CYGPFTNMPTDQLEWMVHLCGASVVKEPSSFTLSKGTHAVVVVQPDAWADNSGFHAIGQM
CEAFVVTREWVLDSVALYQCQELDTYLIPQIPRAAAPASQPCA
NT seq 5532 nt   +upstreamnt  +downstreamnt
atggatttacctgcggatcgtgttgaagaagtacaagatgtcctcaatgctatgcagaaa
atcttggagtgtccaatctgtctggagttgatcaaagagcctgtttccacgaagtgtgat
cacatattttgcaaaagcctacaagaaagtacaagatttagtcaacttgttgaagagctg
ttgaaaatcattcatgcttttgagctggacacaggattgcagtttgtaaacagctataat
ttttcaaaagaaaataactctcccgaccatctaaaggaggaagtttctattatccaaagt
atgggctatcgaaaccgtgccaaaagacttcgacagagtgaacctgaaaaccctaccttg
caggaaaccagtcttagtgtccacctctctgaccttggaattgtgagatctctgaggaca
aagcagcagatacagcctcagaataagtctgtctacattgaattgggatctgattcttct
gaagatacagttaataaggcaagttattgcagtgtgggagacgacgagttgttacaaatc
acccctcaaggagccagggctgaagccagtttgaatcctgcaaaaaaggctgcttgtgaa
atttctgaggacataacaaatattgaatatcatcaatctggtaataaagatttgaccacc
actgagaagcatgcaactgagaagcatccagaaaagtatcagggtatttctgtttcaaac
ttgcatgtggagccatgtggcacaaatactcatgccagctcattacagcatgagaacagc
agtttattactcactaaagacagaatgaatgtagaaaaggctgaagtctgtaataaaagc
aaacagcttggcttagcaaggagccaacagagcagatgggctgaaagtaaggaaacatgt
aatgataggcagactcccagcacagagaaaaaggtacttctgaatgctgatcccctgcat
gggagaaaaaaaccgaggaagcagaaacctgcatgctctgactgtcctagagattctcaa
gatgttccttggataacactgaatagtagcatacagaaagttaatgagtggtttttcaga
agtgatgaaatgttaacttctgatgactcacatgacgggggatctgaatcgaatactgaa
gtagctggtgcagtagaagttccaaatgaagtggacggatattctggttcttctgagaaa
gtagatttaatggccagtgatcctcaggatgctttgatacgtggaagtgaaagagtccac
cccaagtcagtagagagtaatatcgaagataaaatatttgggaaaacctaccggaggaag
gcgagcctccctagccacacgaatgaagatctaattataggagtgcgtgctattgagcct
cagacaacgcgagcccatcccctcacaaataaagcaaagtgtaaaaggagaactacgtca
ggccttcttcctgaggattttatcaagaaagtagatttggccgttgttccaaagactcct
gaaaagctagttgagggaaccaaccaaatcgcgcgaaatggtcacttgatgaatattaca
aataacggtcctgagaatgaagcaaaaggtgattatgttcagaatgagaaaaatgctaac
ccaacagaatcattggaaaaagaatctgcttttagaagcaaagctgaaccgataagcagc
agtataagcaatatggaactggaattaaatagctgctgttcgaaagcctctaagaagaac
agactgaggaggaagtcctccaccaggcacgcttgtgcgcttgaattcgtagtcaataga
aatccaagcccgcctgatcatagcgaactacagatcgatagttgttctagcagtgaagag
atgaagaaacagcatttggaccgaatgccagtcagacacagcaaaacgcttcagctcatg
gaaggtaaagaacctgcaactggagccaggaggggcagtaagccaggtgaacagataaat
aagagacttgccagtcatgctttcccagagctaaatttgacaagtgtacctggtttttcc
gctaactgttcaagttctaataaacctcaagagtttgtcaaccctggccttcaaagagaa
gaaatagaagagagcctaggaagaattcgagtgtctgatagcaccagagatcccaaagag
ctgctcttgggtggaggaagaggtttgcaaactgaaagatctgtggagagtatccatatt
tcactggtacctgatactgattacggcactcaggacagtatctcgttactggaagctgac
accctaaggaaggcaaaaacagcaccaaatcgacgtgcgaatctgtgcgcagcaactgaa
aaccccaaggaacctatccacggttgttctaaagatactagaaatgacacagagggtttt
gcagatccactgacatgtgaagataaccacactcaggagacaagaatagcaatggaagag
agtgaacttgacacacagtatttatacaacacgttcaaggtttcaaagcgtcagtcattt
gctctgttttcaaatccaggagatccagaaaaggactgtgcaatggtctgtgcccactcc
ggggccttaaggaaacaaagtccaaaagtcactcttgaaggtggacaaaaagaagaaaat
cagggaaagaaagagtctgaaatcaagcatgtgcaggcagttcatgcaactgcaggcttt
tctgcagtgagtcagcaagctaagaagccaggtgattatgccaaatgtagcataaaagga
ggcgctaagctttgtccgtcatctccgttcagaggcaaggaaacggaactccttattgca
aataaccgtggaatttcccacaacccttatcatataccaccactttctcccatcagatca
tatgttaaaactctatgtaagaaaaacccgtcagaggaaaggtttgagcagcattcaatg
tcacccgaaagagcaatgggaaatgagagcgtcattcaaagtacagtgagcacaattagc
caaaataacattagagaaagcactttgaaggaagtcagctcaagcagtgttaatgaagta
ggttccagtactaatgaagcaggctctagcattaatgaagtgggttccagtggtgaaaac
gttcaggcagaactaggtagacaccgaggacctaaagtaaacgctatgctcagattaggt
cttatgcaacctgaagtctataagcaaagccctcctgtaagtaattgtaaacatccggaa
atgaaaaggcaaggagaaaacgaaggcgtagttctgtctgttaatgcagatttctctcca
tgtctaatttcagataaccccgaacaaccgatgggaagcactcacgcttctcaggtttgt
tcggagacacctgatgacctattaaatggtgacaaaataaagggaaaaagcagctttgcc
gaaagtgacattagggaaagatctgctgtttttagcaaaagtgtccagaaaggagccttc
ggaaggagccatttagacgaaacacatttggcccagggtcaccaaagaggggccaggaaa
ttagagtcctcagaagagaacacatccagtgaagaggaagagcttccgtgcttccaacac
ttactatttggtaaagtaaccaacacaccttctcagcctaccagtcacaatgctgttgcc
acagagggtctgtctaagaaaacagaggagaacctagactcacggaagaatagtttaagt
gacctcagtaaccagggaccatcagcaaaggcatcccaggaacattatcttagtgaggag
gcaaggtgttctgggagcttattttcttcacagcacagtgcattggaagacttgatagtt
actacaaatagccaggatcctttcttgatgttcgattccccttccaaacaagtgaggcat
cagtctgaaaacctggatgttctgagcgacaaggaattggtttcagatgatgatgatgaa
agggaacttggcctggacgaagataatcacgaagaacagagtgtggattcagacttaggt
gaagcggcatccgggtatgagagtgaaacgagcctctccgaagactgttcagggttgtcc
tctcagagtgatattttaaccactcagcagagggataccatgcaagataacctgataaag
ctccagcaggaaatggccgaactggaagccgtgttagagcagcacgggagccagccttct
cgcagctccccttccctcctagcaggttctggtgccccagaggatctgctaaatccggaa
caaaacacatcaggaaaagcagtattaacttcagagaaaagtagtgactatcctataagc
cagaatcccgaaagcctttctgctgacaaatttcaagtatctctggatagttccaccagt
aaaaataaagaaccaggaacaagaaggtcttccccttctccatcccggttgttagatacc
aggtggtatgtgcacagcggcccaaggaatcttcagaacagaaactgcccgtctcaaaag
gagctcattaaggtcgtcagtgtggaggaacaagcaccgactaagtcagaggcgcaagag
gtcgtggagcagtctttgccaagaccagatctggagggaaccccttacctcgagtctgga
atcagcctcttctctgatgaccctgagtctgatccctctgcagacagagccccagagcca
gctcatgttagcagcatgccaacttcaacctctgctttgaaattaccccaatttcaagtt
gaagaatcagccaagagtacagctgctgtccatgttgctaatactgctgggtataataag
agggaagacactgtgggcagggagaagccagaagttatatcttcagtaaaaaaaatcaac
ggagcaatatctatggtggcatcaggcttaaccccaaaagaatttatgcttgtgcagaag
tttgccaaaaaacaccacattgctttaacgaatcaaatttctgaagagactactcacgtc
atcatgaaaacagatgctgagtttgtgtgcgaacggacgctgaaatattttctgggtatc
gcaggaggaaaatgggtagttagctatttctgggtgacccagtctattaaagaaagaaag
atactagatgagcatgattttgaagtcagaggagatgttgtgaatggaagaaaccaccaa
ggtccgaagcgagcaagagaatcccaggacagaaagatcttcaggggcctagaagtctgt
tgctatgggccctttaccaacatgcccacagatcagctagagtggatggtgcacctctgt
ggggcttctgtggtgaaggagccttcgtcattcactcttagcaagggtactcacgcagtg
gtggtcgtgcagccggatgcctgggcagacaacagtggcttccatgcgattgggcagatg
tgtgaggcatttgtggtgacccgagagtgggtgttggacagtgtagccctctaccagtgc
caggagctggacacctacctgatcccgcagattcccagagctgctgctcccgccagccag
ccatgtgcatag

DBGET integrated database retrieval system