KEGG   Ailuropoda melanoleuca (giant panda): 100484344
Entry
100484344         CDS       T01329                                 

Gene name
BCL2
Definition
(RefSeq) LOW QUALITY PROTEIN: apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04064  NF-kappa B signaling pathway
aml04066  HIF-1 signaling pathway
aml04071  Sphingolipid signaling pathway
aml04115  p53 signaling pathway
aml04140  Autophagy - animal
aml04141  Protein processing in endoplasmic reticulum
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04217  Necroptosis
aml04261  Adrenergic signaling in cardiomyocytes
aml04340  Hedgehog signaling pathway
aml04510  Focal adhesion
aml04621  NOD-like receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04722  Neurotrophin signaling pathway
aml04725  Cholinergic synapse
aml04915  Estrogen signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05014  Amyotrophic lateral sclerosis
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05162  Measles
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05215  Prostate cancer
aml05222  Small cell lung cancer
aml05226  Gastric cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100484344 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100484344 (BCL2)
   04630 JAK-STAT signaling pathway
    100484344 (BCL2)
   04064 NF-kappa B signaling pathway
    100484344 (BCL2)
   04066 HIF-1 signaling pathway
    100484344 (BCL2)
   04071 Sphingolipid signaling pathway
    100484344 (BCL2)
   04151 PI3K-Akt signaling pathway
    100484344 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100484344 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    100484344 (BCL2)
   04215 Apoptosis - multiple species
    100484344 (BCL2)
   04217 Necroptosis
    100484344 (BCL2)
   04115 p53 signaling pathway
    100484344 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100484344 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100484344 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100484344 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    100484344 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100484344 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    100484344 (BCL2)
   04722 Neurotrophin signaling pathway
    100484344 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100484344 (BCL2)
   05206 MicroRNAs in cancer
    100484344 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100484344 (BCL2)
   05226 Gastric cancer
    100484344 (BCL2)
   05215 Prostate cancer
    100484344 (BCL2)
   05222 Small cell lung cancer
    100484344 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100484344 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100484344 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100484344 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100484344 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100484344 (BCL2)
   05152 Tuberculosis
    100484344 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100484344 (BCL2)
   05161 Hepatitis B
    100484344 (BCL2)
   05162 Measles
    100484344 (BCL2)
   05168 Herpes simplex virus 1 infection
    100484344 (BCL2)
   05169 Epstein-Barr virus infection
    100484344 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100484344 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100484344 (BCL2)
   01524 Platinum drug resistance
    100484344 (BCL2)
   01522 Endocrine resistance
    100484344 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100484344 (BCL2)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100484344 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100484344
NCBI-ProteinID: XP_034498428
LinkDB
Position
14
AA seq 260 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPA
RTSPPTAXPAAPAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF
TARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRH
LHTWIQDNGGWAVWMDTSLGCHSPRHGAFGLQEINQDAFVELYGPSMQPLFDFSWLSLKA
LLSLALVGACITLGAYLGHK
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgccggagacgcgggcgccgctcccccg
ggggccgcccccgcgccgggcatcttctcctcccagcccgggcgcacccccgcgcccgcc
aggacctcgccgcccaccgccnncccggccgcccccgccgccgccgccgccgcgggccct
gcgctcagccccgtgccacctgtggtccacctgaccctgcgccaggccggcgatgacttc
tcccgtcgctaccgccgcgacttcgcggagatgtccagccagctgcacctgacacccttc
accgcaaggggacgctttgccacggtggtggaggagctcttcagggatggggtgaactgg
gggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgg
gagatgtcgcccctggtggacaacattgccctgtggatgactgagtacctgaaccggcac
ctgcacacctggatccaggacaacggaggctgggccgtgtggatggatactagcttgggc
tgccatagtcccaggcacggagcttttggacttcaagagataaatcaggatgcctttgtg
gagttgtacggccccagcatgcagcctctgtttgacttctcctggctgtctctgaaggcc
ctgctcagtctggccctggtgggagcttgcatcaccctgggtgcctacctgggccacaag
tga

DBGET integrated database retrieval system