KEGG   Asparagus officinalis (garden asparagus): 109848950Help
Entry
109848950         CDS       T05243                                 

Definition
(RefSeq) hexokinase-3-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00010  Glycolysis / Gluconeogenesis
aof00051  Fructose and mannose metabolism
aof00052  Galactose metabolism
aof00500  Starch and sucrose metabolism
aof00520  Amino sugar and nucleotide sugar metabolism
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
aof01200  Carbon metabolism
Module
aof_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aof_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109848950
   00051 Fructose and mannose metabolism
    109848950
   00052 Galactose metabolism
    109848950
   00500 Starch and sucrose metabolism
    109848950
   00520 Amino sugar and nucleotide sugar metabolism
    109848950
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109848950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aof04131]
    109848950
Enzymes [BR:aof01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109848950
Membrane trafficking [BR:aof04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109848950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 109848950
NCBI-ProteinID: XP_020274278
LinkDB All DBs
Position
7
AA seq 500 aa AA seqDB search
MGRVGLGLAVGCAAISCTIAGILVTKRIKNRRKWSRVVEILSEFEDGCSTSIARLRQVVD
AMAVEMHAGLASDGGSKLKMLLTFVDRLPDGEEKGTYYALDLGGTNFRVLRIQLGGNRSV
ILKHEVERQPIPENLMMGTSEDLFDFIAMSLKHFVVKEEGSEQRPDRSRELGFTFSFPVR
QVSVSSGFLIKWTKGFAIEDAVGKDVAQCLEEAMTRRGLDMRVAALVNDTVGTLALGHYH
DEDTVAAVIIGTGTNACYVERTDAIIKCQGLLTNSGGMVVNMEWGNFWSSHLPRTSYDVD
LDDETANHNDQGFEKMISGMYLGDITRRVLYRIAQESDIFGDAAASLSAPFVLRTPLMAA
MHEDDSPDLREVSRILQENLQMPEISLKARRLVVGVIDIVTRRAARLAAAGIVGILKKIG
RDGSGGIGSGKTKGKIRRSVVAIEGGLYSGYSMFREYLNEAVVEILGDEVAESVVLRVSE
DGSGIGAALLAATAAHSSDR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggccgggtgggcttagggttggcggtgggctgcgcagcaatctcctgcacaatcgca
ggaatcctagtgaccaaacgaatcaagaaccgccgaaagtggtcgagggtcgtcgagatc
ctcagcgagttcgaggacggatgctcgacttcgatcgcgaggctgaggcaggtggtggac
gccatggccgtggagatgcacgccggcctcgcctccgacggcggcagtaagctcaagatg
ctcctcactttcgtcgaccgcttacctgatggggaagaaaaaggtacttactatgctctt
gatttgggtggtaccaactttagagttttgcggattcagcttggaggtaacaggtctgtg
attctaaagcatgaagtggagcgacaaccaattcctgaaaatttgatgatgggtaccagt
gaggacctatttgattttattgccatgagtttgaaacatttcgttgttaaagaggagggt
tctgaacaaagaccagacagaagtagagaacttggatttacattttcatttcctgttaga
caggtgtctgtttcgtccggattccttatcaaatggacaaagggatttgcaattgaagat
gctgttggaaaagatgttgctcagtgcttagaagaagccatgaccaggagggggctggat
atgcgggtggcagcattggttaatgatactgtggggacattggcacttggtcattatcat
gatgaggacactgttgctgcagtgattatcgggacaggcaccaatgcctgctatgtggaa
cgcactgatgctataattaaatgtcaaggacttcttacaaattcgggtggaatggttgta
aatatggaatggggtaatttttggtcatcacatttgccaagaacttcatatgatgttgac
ctagatgatgagaccgcaaaccataatgatcagggttttgagaaaatgatatcaggaatg
tatttaggtgatatcacgagaagggtgctttataggatagcacaggaatcagatattttt
ggagatgctgctgctagtttatctgctccttttgtactaaggacgcctttgatggctgcc
atgcatgaggatgattctcctgacctacgagaagtcagcagaatactgcaagaaaacctg
cagatgccagaaatttcattaaaagcaagaagactcgtcgtaggagtcattgacatcgtc
acccgaagggctgctcgcttagccgcagctggcattgtcggaatactaaagaaaatagga
agagatgggagtggaggtatcggtagtgggaaaaccaaaggaaaaatacgaagaagtgtg
gttgctatcgagggaggtctttattcaggatattccatgttcagagagtacttgaatgaa
gcggtggtggagatattaggagatgaagttgcagagagtgtagttttaagagtgtctgag
gatggttcagggattggtgctgctctacttgctgctacggctgcacattcatcagataga
taa

DBGET integrated database retrieval system