Achromobacter pestifer: FOC84_09370 Help Entry FOC84_09370       CDS       T09260                                  Name (GenBank) acyl carrier protein   KO K14188   D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13] Organism apes  Achromobacter pestifer Pathway apes00470   D-Amino acid metabolism apes00552   Teichoic acid biosynthesis apes01100   Metabolic pathways apes01503   Cationic antimicrobial peptide (CAMP) resistance apes02020   Two-component system Brite KEGG Orthology (KO) [BR:apes00001]  09100 Metabolism   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     FOC84_09370   09107 Glycan biosynthesis and metabolism    00552 Teichoic acid biosynthesis     FOC84_09370  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     FOC84_09370  09160 Human Diseases   09175 Drug resistance: antimicrobial    01503 Cationic antimicrobial peptide (CAMP) resistance     FOC84_09370  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:apes01504]     FOC84_09370 Enzymes [BR:apes01000]  6. Ligases   6.1  Forming carbon-oxygen bonds    6.1.1  Ligases forming aminoacyl-tRNA and related compounds     6.1.1.13  D-alanine---poly(phosphoribitol) ligase      FOC84_09370 Antimicrobial resistance genes [BR:apes01504]  Gene sets   CAMP resistance modules    Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]     FOC84_09370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GD_AH_second Motif Other DBs NCBI-ProteinID:  QKH35137 UniProt:  A0A7D4HQ01 LinkDB All DBs Position complement(1928493..1928732) Genome browser AA seq 79 aa AA seqDB search MHTEQELHTKIGEIVESIVMKKVTPDTQLIATGLVDSLAAVDITLAVESEYGCSIPAPEI AEHLQSVRTLAGYVAAHTS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcataccgagcaagaactccacaccaagatcggcgagatcgtcgagtcgatcgtcatg aagaaagtcaccccagatacgcagttgattgccaccggtctggtcgattcgctcgctgcc gtggacatcacgctggcggtcgagtcggagtacggctgcagcatcccggctcccgagatc gcggaacacctacagtcggtccgcacgcttgccggctatgtcgctgcccatacttcgtaa

DBGET integrated database retrieval system