KEGG   Alligator sinensis (Chinese alligator): 102377475
Entry
102377475         CDS       T02922                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04010  MAPK signaling pathway
asn04020  Calcium signaling pathway
asn04260  Cardiac muscle contraction
asn04261  Adrenergic signaling in cardiomyocytes
asn04270  Vascular smooth muscle contraction
asn04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102377475 (CACNA1C)
   04020 Calcium signaling pathway
    102377475 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102377475 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102377475 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102377475 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102377475 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:asn04040]
    102377475 (CACNA1C)
Ion channels [BR:asn04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102377475 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102377475
NCBI-ProteinID: XP_025054589
UniProt: A0A3Q0G4J0
LinkDB
Position
Unknown
AA seq 2175 aa
MFQAFKRQATSAYQPLPSRVPGELEVKYKGKLVHETQLNCFYIPPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQK
KQGTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYHVHGALADTPAEEDPSPCAPQSAHGRQCQNG
TECRAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLV
IFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDP
ENEDEGMDEEKPRNMSMPTSETESVNTDNVAGADIEGENCGARLAHRISKSKFSRYWRRW
NRFCRRKCRAAVKSNVFYWLGVFLVFFNTLTIASEHYQQSNWLTEVQDTANKVLLALFTA
EMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMPPLGISVLRCVRLLRIFK
ITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTF
DNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFL
AIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKPAVEEETKEEKIELKSI
TADGESPPATKINVDDYQPNENEEKNPYPTTEAPGEEDEEEPEMPVGPRPRPMSELHLKE
KAVPMPDASAFFIFSPSNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHTSFR
NQILFYFDIVFTVIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSS
AINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQ
LFKGKLYSCSDSSKQTLTECRGYFITYKDGEVTQPMIQPRSWENSKFDFDNVLTAMMALF
TVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTF
QEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLI
LLXXXXXXXXXNTICLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFKPKGYFS
DPWNVFDFLIVIGSIIDVILSETNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLL
SRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTGINRNNNFQ
TFPQAVLLLFRCATGEAWQEIMLACLSGKKCDPESEPANSTEGDHSCGSSFAIFYFISFY
MLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTL
LRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQ
ANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLV
GKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAG
GLFGNHVNYYQSDGRSTFPQTFTTQRPLHINKSGNNQGDTESPSHEKLVDSTFTPSSYSS
SGSNANINNANNTALCRFPSPPNFPSTVSTVEGHGTPLSPTICVQEAPWKLGSKSSGSRD
SQLAIVCQEEVSQDETYDENLNEDVEYCSEPSLISTEMLSYQDDENRQLTLPENNKGEDA
RQSPRKGFLCSSSLGRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLL
QRSHSPTMFSRLCATPPATPSSCGWPEQTIPTLRLDGAESSEKLNSSFPSIHCSSWYSDR
ASCSSTRRARPVSLTVPSQTGGSGRQFHGSAGSLVEAVLISEGLMQFAQDPKFIEVTTQE
LADACDMTIEEMENAADNILNGNSKQSPNGNLLPFVNCRDPGQDSAGEEEEEVQNPDCRK
SQEELKDSRIYISSL
NT seq 6528 nt   +upstreamnt  +downstreamnt
atgtttcaagccttcaagcggcaagccacctctgcatatcagccactacctagccgtgtg
ccaggtgaactggaggtgaagtataagggcaagctggtgcatgagactcagctcaactgc
ttctatattccacctggaggttccaactatgggagtccccgtccagctcatgccaacatg
aatgccaatgcagctgcagggcttgccccagagcatatccctactccaggggcagctctg
tcctggcaggctgctatcgatgctgccagacaggccaaattgatgggtagtgctggcaat
gcaacaatatccacagctagctccacacagaggaaacggcagcagtatgggaaacagaaa
aaacagggtactaccacagctacacgtcctccccgggcattgctgtgtttaacactgaaa
aatcccatccggagggcatgtatcagcatcgtcgaatggaaaccatttgaaataattatt
ttactgactattttcgccaattgtgtggccttagctatctatatcccctttccagaagat
gattccaatgccaccaattccaatctggaacgagtggaatatctctttctcataattttt
acagtggaagcatttttaaaagtaatagcatatggacttctctttcaccccaacgcttac
ctccgcaatggctggaatttactagattttataattgtggtagtagggctttttagtgca
attttagaacaagcaaccaaagcagatggggggaattcaataggagggaaaggtgccgga
tttgatgttaaagcactgagggcttttcgagtgttacgccccttacggctggtatctgga
gttcctagtctccaggtggttttaaattcaatcatcaaggccatggttcccttgttgcac
attgccctgctggtgctgtttgtcataattatctatgccatcattgggctggagctattc
atggggaagatgcacaagacctgctaccatgtgcatggggcactagcagatacacctgca
gaagaggatccttctccttgtgctcctcagtcagcacatggacggcagtgtcagaatggc
acagagtgcagagctggctgggaaggccctaagcatggcattacaaactttgacaatttt
gcttttgccatgttaactgtgtttcagtgcatcactatggaaggctggacagatgtactg
tactggatgcaggacgctatgggctatgagttaccatgggtgtattttgtcagtctggtc
atctttggatcctttttcgttctaaatctggttcttggtgtgttgagcggggagttttcc
aaggaaagagaaaaggcaaaggcccggggtgactttcagaagttgcgggagaagcagcaa
ctggaggaggacttgaaggggtacctggactggataactcaagcagaagacattgatcca
gaaaatgaagatgaaggcatggatgaggagaagcctagaaacatgagcatgcccacaagt
gagacggagtctgtaaacacagacaatgtggctggagctgacattgaaggagaaaactgt
ggtgcaaggctggcgcatcggatctccaaatctaagtttagccggtactggcgccggtgg
aaccggttctgcaggagaaagtgtcgagctgctgtcaagtccaatgttttctattggctg
ggggttttccttgtgttcttcaacactctcaccattgcctctgaacactaccagcagtcg
aactggctcactgaggtccaagatactgccaataaggtgctgctagctcttttcacggca
gagatgctgctgaagatgtacagccttggtctccaggcctactttgtgtctctcttcaac
cgctttgactgctttattgtttgtggaggaatcctggaaacaattctggtggagaccaag
ataatgccaccactgggcatctcagtgttgcgatgtgtccgactcctgagaatatttaag
atcacaaggtattggaattccctgagtaacctcgtagcttcgttactgaactctgtccgc
tccatcgcctccttgttgctgcttctcttcctcttcatcatcatcttctcactcctggga
atgcagctctttgggggcaagtttaactttgatgagatgcaaaccaggaggagcacattt
gacaacttcccccagtctctcctcactgtgtttcagatcctgactggggaggactggaat
tcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggaatgttggtc
tgtatttacttcatcatcctcttcatctgtggaaactatatcctcctgaatgtatttttg
gccattgcggtagacaatcttgccgatgctgagagtttgacatctgcacaaaaagaagag
gaagaggaaaaagaaaggaaaaaactagctaggactgctagtccagaaaagaaacaggag
atagagaagccagctgtggaggaggagacaaaggaggagaaaatagagctgaaatcgatc
actgctgatggagagtccccacctgctaccaagatcaatgtggatgactatcagcccaat
gaaaatgaagaaaagaatccatatcccactactgaagctccaggagaggaagatgaggag
gagcctgagatgcctgtgggtcctcggccacgcccaatgtctgaactgcatctcaaggaa
aaagctgtgcccatgccagatgccagtgctttctttatcttcagcccaagcaacaggttt
cgtgtccactgccatcgcatcgttaatgataacattttcaccaacctgatcctctttttc
atcttgctcagcagcatctctctggcagccgaggaccctgtccgacacacctcctttagg
aaccaaattctcttttattttgatatagtttttactgtcattttcaccattgaaattgct
ctgaagatgactgcatatggggctttccttcacaagggctccttctgcaggaactacttc
aacatcctagatctgctggtagtcagcgtttctctcatctcctttgggatccaatctagt
gccatcaacgtagtgaagatcttacgtgtactacgagtgctcagaccattgagggccatc
aacagagccaaagggctaaagcatgtggtccagtgcgtgtttgttgccatcagaaccatt
gggaacatagtgatcgtcaccactttgctgcagttcatgtttgcctgcattggagttcag
ttgttcaagggcaaactgtatagctgcagtgatagctccaagcaaacactcacagagtgc
agggggtatttcattacatacaaagatggcgaggtcacccagccaatgatccagccccgg
agctgggagaacagcaagtttgactttgacaacgttttgactgccatgatggcgctcttt
actgtttcaacttttgagggctggccagagttgttgtacagatccattgattcccacatg
gaagatgttggacccatctataaccacagggtggagatctccattttcttcatcatctat
atcatcatcattgccttcttcatgatgaacatctttgttggtttcgtcattgtcacgttt
caggaacaaggagagcaggagtacaagaactgtgaactggacaagaatcagcgtcagtgt
gtagaatatgccctgaaggctcgtcccctgaggaggtacatccctaagaaccaataccaa
tataaagtgtggtatgtggtgaactccacctattttgagtacctgatgttcgttctgatc
ctgctgnnnnnnnnnnnnnnnnnnnnnnnnnnnaacacaatctgcctggccatgcaacac
tacggtcagagctgcatgtttaaggaagccatgaatatcctcaacatgctcttcactggt
ctcttcactgttgagatggttctgaaactaatcgccttcaaacctaagggttactttagt
gatccttggaatgtttttgacttcctcatcgtaattggcagcattatagacgtcattctc
agtgaaactaatccagctgaacatacccaatgctcttcctctatgaatgcagaggaaaac
tctcgcatctcaatcacctttttccgactcttccgcgtgatgcgtcttgtgaagctcctg
agccgaggggagggcatccggacactgctttggaccttcatcaagtccttccaggctctc
ccctatgtggctctactaatagtgatgctattcttcatctatgctgtgattgggatgcag
gtgtttggtaaaattgcgctgaacgataccacaggaatcaaccgcaacaacaactttcag
accttcccacaagcagtactgctgcttttcaggtgtgccacaggtgaggcctggcaggag
atcatgctggcctgcctgtcaggcaagaagtgtgatcctgaatcagaaccagccaactct
actgaaggcgaccattcctgtgggagcagctttgccatattttatttcatcagcttctac
atgctctgtgccttcctgatcatcaatctttttgtagctgttataatggataactttgat
tacctgacgcgggactggtccattttaggaccacaccacctggatgagtttaaaaggatt
tgggcagagtatgatcctgaagccaagggacggatcaaacaccttgatgtggtgacactg
ctccggaggattcagcctccacttggctttgggaagctctgtcctcatagagtggcttgc
aagcgcctcgtctccatgaatatgccactaaatagtgatgggactgtcatgtttaatgct
actctctttgcattggtcagaacagcactgaggatcaaaactgaaggtaacctggagcaa
gctaatgaggaactgcgagcaataataaagaaaatctggaagcgcaccagtatgaagctg
ctggatcaggtcgtgcccccagctggcgatgacgaggtgactgttgggaagttttatgcc
actttcctgatccaagagtatttccggaaattcaagaaacgcaaagaacagggcctagtt
ggcaaaccctcacagaggaatgctctctccctgcaggctggtctgcgcacactgcatgac
attgggccagagatccgacgggcaatctcaggggacctgacagctgaagaggaactagac
aaggccatgaaagaagctgtctctgctgcttctgaagatgatatctttaggagggctggt
ggcttgttcggaaaccatgtcaactactaccaaagtgatggcagaagcaccttcccccag
acattcactacccagcgccctttgcacatcaataaatctggcaacaaccagggagatact
gagtccccatcccatgagaagctagtggattccacctttactcctagcagctactcttct
tcaggttctaatgccaacatcaacaatgccaacaacactgccttgtgccgcttcccaagc
ccacccaattttccaagcactgtcagcacggtagagggacatggcacccccttgtcaccc
accatatgtgtgcaggaggccccttggaaacttggatccaaaagctccggttccagagac
agccagctggcaatcgtttgccaagaggaagtgtctcaggatgagacttatgatgaaaat
ttgaatgaagatgttgaatactgcagtgagccaagcctgatctctactgaaatgctctca
taccaagatgatgaaaacagacagctgacgctaccggaaaataacaaaggggaagacgcc
aggcagtctccaaggaagggatttctttgctcctcatcattaggtcgaagagcatcattt
catttggagtgtctgaagagacagaagaaccaaggtgtagatgtctcacagaagacagtt
ctgcccttacatctggtacatcatcaggcactagctgtggcgggtctgagtcccctgctc
caaagaagccattccccaaccatgttctcccggttgtgtgccacaccccctgccacaccc
tctagctgtggctggccagagcagaccatcccaactttgcggcttgacggagcagagtcc
agtgagaaactcaacagtagcttcccgtcgatacactgcagctcttggtactctgaccgt
gccagctgcagcagcactagaagagcccggccggtctctctcactgtccccagccaaact
ggagggagtggcaggcagttccacggcagtgctggcagccttgttgaagcggtcttgatt
tcggaaggactgatgcagtttgctcaagatccaaagtttattgaggtcacaacccaagag
ctagcggatgcgtgtgacatgacgatagaagagatggaaaatgcagcagacaacattctc
aatggtaacagcaagcagagccccaatggcaacctcttgccttttgttaactgcagggac
ccagggcaggacagtgcaggagaggaagaggaagaggtgcaaaacccggattgtagaaaa
agtcaggaggagctcaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system