Actinomarinicola tropica: GH723_14760 Help Entry GH723_14760       CDS       T06914                                  Name (GenBank) hypothetical protein   KO K07260   zinc D-Ala-D-Ala carboxypeptidase [EC:3.4.17.14] Organism atq  Actinomarinicola tropica Pathway atq00550   Peptidoglycan biosynthesis atq01100   Metabolic pathways atq01502   Vancomycin resistance atq02020   Two-component system Brite KEGG Orthology (KO) [BR:atq00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00550 Peptidoglycan biosynthesis     GH723_14760  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     GH723_14760  09160 Human Diseases   09175 Drug resistance: antimicrobial    01502 Vancomycin resistance     GH723_14760  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:atq01002]     GH723_14760    01011 Peptidoglycan biosynthesis and degradation proteins [BR:atq01011]     GH723_14760   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:atq01504]     GH723_14760 Enzymes [BR:atq01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.17  Metallocarboxypeptidases     3.4.17.14  zinc D-Ala-D-Ala carboxypeptidase      GH723_14760 Peptidases and inhibitors [BR:atq01002]  Metallo peptidases   Family M15: zinc D-Ala-D-Ala carboxypeptidase family    GH723_14760 Peptidoglycan biosynthesis and degradation proteins [BR:atq01011]  Peptidoglycan biosynthesis and degradation   Carboxypeptidase    GH723_14760 Antimicrobial resistance genes [BR:atq01504]  Gene sets   Vancomycin resistance modules    Vancomycin resistance, D-Ala-D-Lac type [MD:M00651]     GH723_14760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  VanY Peptidase_M15_4 Motif Other DBs NCBI-ProteinID:  QGG97136 UniProt:  A0A5Q2RRN6 LinkDB All DBs Position 3007572..3007862 Genome browser AA seq 96 aa AA seqDB search MTGERVVPSLATRWPHPIGETHTQVVPPHWRATEKGLYSQGGLAATPGTSNHGWGLSVDL DLNPASEAWMKANAPRFGFVEDVPREPWHWTYRPAQ NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atcactggcgaacgggtggtcccatcactggcgacgagatggccccatcccattggcgaa actcacacccaggtggtcccaccccactggcgggcgacagagaagggtctctactcccaa gggggactcgcggctactccaggcacgagcaaccacggatggggtctctcggtcgacctc gacctgaaccccgcgtccgaggcttggatgaaggcgaacgccccacgcttcggcttcgtg gaggacgtgccgcgagaaccgtggcactggacctaccgaccagcccagtag

DBGET integrated database retrieval system