KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003426
Entry
103003426         CDS       T03086                                 

Gene name
TP53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04010  MAPK signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04110  Cell cycle
bacu04115  p53 signaling pathway
bacu04137  Mitophagy - animal
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04216  Ferroptosis
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05016  Huntington disease
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103003426 (TP53)
   04310 Wnt signaling pathway
    103003426 (TP53)
   04071 Sphingolipid signaling pathway
    103003426 (TP53)
   04151 PI3K-Akt signaling pathway
    103003426 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103003426 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    103003426 (TP53)
   04210 Apoptosis
    103003426 (TP53)
   04216 Ferroptosis
    103003426 (TP53)
   04115 p53 signaling pathway
    103003426 (TP53)
   04218 Cellular senescence
    103003426 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103003426 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103003426 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    103003426 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103003426 (TP53)
   05202 Transcriptional misregulation in cancer
    103003426 (TP53)
   05206 MicroRNAs in cancer
    103003426 (TP53)
   05205 Proteoglycans in cancer
    103003426 (TP53)
   05203 Viral carcinogenesis
    103003426 (TP53)
   05230 Central carbon metabolism in cancer
    103003426 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103003426 (TP53)
   05212 Pancreatic cancer
    103003426 (TP53)
   05225 Hepatocellular carcinoma
    103003426 (TP53)
   05226 Gastric cancer
    103003426 (TP53)
   05214 Glioma
    103003426 (TP53)
   05216 Thyroid cancer
    103003426 (TP53)
   05220 Chronic myeloid leukemia
    103003426 (TP53)
   05217 Basal cell carcinoma
    103003426 (TP53)
   05218 Melanoma
    103003426 (TP53)
   05219 Bladder cancer
    103003426 (TP53)
   05215 Prostate cancer
    103003426 (TP53)
   05213 Endometrial cancer
    103003426 (TP53)
   05224 Breast cancer
    103003426 (TP53)
   05222 Small cell lung cancer
    103003426 (TP53)
   05223 Non-small cell lung cancer
    103003426 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103003426 (TP53)
   05014 Amyotrophic lateral sclerosis
    103003426 (TP53)
   05016 Huntington disease
    103003426 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103003426 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103003426 (TP53)
   05161 Hepatitis B
    103003426 (TP53)
   05160 Hepatitis C
    103003426 (TP53)
   05162 Measles
    103003426 (TP53)
   05168 Herpes simplex virus 1 infection
    103003426 (TP53)
   05163 Human cytomegalovirus infection
    103003426 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103003426 (TP53)
   05169 Epstein-Barr virus infection
    103003426 (TP53)
   05165 Human papillomavirus infection
    103003426 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103003426 (TP53)
   01522 Endocrine resistance
    103003426 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103003426 (TP53)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103003426 (TP53)
   03400 DNA repair and recombination proteins [BR:bacu03400]
    103003426 (TP53)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    103003426 (TP53)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103003426 (TP53)
DNA repair and recombination proteins [BR:bacu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    103003426 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD TAD2
Other DBs
NCBI-GeneID: 103003426
NCBI-ProteinID: XP_007166447
UniProt: A0A383YUA7
LinkDB
Position
Un
AA seq 387 aa
MEESQAELGVEPPLSQESFSDLWKLLPENNLLSSELSPAVDDLLLSPEDVANWLDERPDE
APQMPEPTAPAAPAPAAPAPATSWPLSSFVPSQKTYPGSYGFRLGFLHSGTAKSVTCTYS
PALNKLFCQLAKTCPVQLWVSSPPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERCSDYSD
GLAPPQHLIRVEGNLRAEYLDDRHTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGM
NRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGQSGPEPPPGSAKR
ALPTSTSSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGRELGESRAHS
SHLKSKKGQSPSRHKKLMFKREGPDSD
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggaggagtcacaggcagaactcggcgtggagccccctctgagtcaggagagcttttca
gacttgtggaaactgcttcctgaaaacaaccttctgtcctctgagctctccccggccgtg
gatgacctgctgctgtccccagaagacgtcgcaaactggctggatgaacgtccagatgaa
gccccccaaatgccggagcctactgcgcccgctgcccccgccccagccgccccagcacca
gccacctcctggcccctgtcgtcctttgtcccttcccagaagacctaccctggcagctat
gggttccgtctaggtttcctacattctggaactgccaagtctgtaacctgcacgtattcc
cctgccctcaacaagctgttttgccagctggccaagacctgcccggtgcagctgtgggtc
agctcaccacccccgcccggcacccgggtccgtgccatggccatctacaagaagtcagag
tacatgacggaggttgtgaggcgctgtccccaccacgagcgctgctctgactatagcgac
ggtctggcccctcctcagcatctcatccgggtggaagggaatttacgtgctgagtatttg
gacgacagacacacttttcgacacagcgtggtggtgccctacgagccgcccgaggttggc
tctgactgtaccaccatccactacaacttcatgtgtaacagctcctgcatggggggcatg
aaccggcggcccatcctcaccatcatcacactggaagactccagtggtaatctgctggga
cggaacagcttcgaggtgcgtgtttgtgcctgtcctgggagagaccgccgcacagaggaa
gaaaatttccgcaagaaggggcagtctggccctgagccgccccctgggagcgctaagcga
gcactgcctaccagcaccagctcctctccaccgcaaaagaagaaaccactggatggagaa
tatttcactctccagatccgtgggcgtgaacgctttgagatgttccgagagctgaatgag
gccttggagctgaaggatgctcaggctggaagggagctcggggagagcagggctcactct
agccacctgaagtctaagaaggggcagtctccctcccgccataaaaaactgatgttcaag
agagaagggcctgactcagactga

DBGET integrated database retrieval system