KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013616
Entry
103013616         CDS       T03086                                 

Gene name
IKBKE
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04623  Cytosolic DNA-sensing pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103013616 (IKBKE)
   04621 NOD-like receptor signaling pathway
    103013616 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    103013616 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    103013616 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    103013616 (IKBKE)
   04657 IL-17 signaling pathway
    103013616 (IKBKE)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    103013616 (IKBKE)
   05160 Hepatitis C
    103013616 (IKBKE)
   05171 Coronavirus disease - COVID-19
    103013616 (IKBKE)
   05164 Influenza A
    103013616 (IKBKE)
   05162 Measles
    103013616 (IKBKE)
   05168 Herpes simplex virus 1 infection
    103013616 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103013616 (IKBKE)
   05169 Epstein-Barr virus infection
    103013616 (IKBKE)
   05165 Human papillomavirus infection
    103013616 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103013616 (IKBKE)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     103013616 (IKBKE)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103013616 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like zf-RING_9 TMPIT
Other DBs
NCBI-GeneID: 103013616
NCBI-ProteinID: XP_007195212
UniProt: A0A384B6C6
LinkDB
Position
Un
AA seq 752 aa
MTTSPESSGGATQSHKPACPTAEMGRWPASWEQEMQSTVNYLWHTDDLLGQGATASVYKA
RNKKSGELVAVKVFNTASYLRPREVQVREFEVLRKLNHQNIIKLFAVEEMGGSRQKVLVM
EYCASGSLMSVLEGPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVG
EEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPAMYERAVLRKPQQKAFGVAVDLWS
IGVTLYHAATGSLPFVPFGGPRRNKEIMYRITTEKPAGAIAGTQRLENGPLEWSYTLPIT
CQLSMGLQSQLVPILANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLPQAVMHHVYI
HAHNTIAIFLEAVYKQTNVAPQHQEYLFEGHLCVLEPSLSAQHIAHTTASSPLTLFSMVS
ETPKGLAFRDPALDIPKFVPKVDLQADYNTAKGVLGAGYQALRLAQALLAGQELMLRGLH
WFVEILQATCRRTLEVTRMALLFLSSSLGTERFSNMAGVTEIQELKRAAELRSKLRTLAE
VLSRCSHNITETKMTLSNLSSELMKNRDQVHEDRSIQQIQCCLDKMYLIYKQFKKSRMRP
GLGYNEEQIHKLDKVNFSHLAKRLLQVFQEERVQKYQASLVTHGKRMRVVHETRNHLRLV
GCSVAACNTEAQGAQESLSKILDWLSHQLLQDRTKGAQASPPPTAPYPSPALKDLVLHMQ
ELCKEMKVLASDLQDNNRVIEGLSRVPSAPDI
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgacaacaagccctgaaagctctgggggcgccacgcagtcccacaagcctgcatgcccc
acagccgagatgggaaggtggccggccagctgggagcaggagatgcagagcaccgtcaat
tacctgtggcacacggatgacctgctggggcagggggccactgccagtgtgtacaaggcc
cgaaacaagaaatccggggagctggttgctgtgaaggtcttcaacacggccagctacctg
cgaccccgcgaggtgcaggtgagggagtttgaggtcctgcggaagctgaaccatcagaac
atcatcaagctctttgcggtggaggagatggggggcagccggcagaaggtgctggtgatg
gagtactgcgccagcgggagcctgatgagcgtgctggagggccctgagaacgcctttggg
ctgcccgaggacgagttcctggtggtgctgcgctgtgtggtggccggcatgaaccacctg
cgggagaacggcatcgtccaccgagacatcaagccggggaacatcatgcgcctggtcggg
gaggaggggcagagcatctacaagctgacggacttcggggcagcccgggagctggatgac
gacgagaagttcgtctcggtctacggcactgaggagtacctgcatcctgctatgtatgag
cgggcggtgcttcgcaagccccaacagaaagcttttggggtggccgtggatctctggagc
attggggtgaccctgtaccatgcggccactggcagcctgcccttcgtcccctttggaggg
ccccggcgcaacaaggagatcatgtaccggatcaccacggagaagccagccggggccatt
gcaggcactcagaggctggagaacgggcccctggagtggagctacaccctccccatcacc
tgccagctgtccatggggctgcagagccagctggtgcccatcctggccaacatcctggag
gtggagcaggccaagtgctggggcttcgaccagttctttgcagagaccagtgacatcctg
cagcgagttgtcgtccacgtcttctccttgccgcaggccgtcatgcaccacgtctacatc
cacgcgcacaacacgatagccatctttctggaggccgtgtacaagcagaccaacgtggcc
ccccagcaccaggagtacctctttgagggtcacctctgtgtcctcgagcccagcctctca
gcacagcacattgcccacacgacagcaagcagccccctgaccctgttcagcatggtcagc
gagacccccaaggggctggccttcagggaccctgctctggacatccccaagtttgtcccc
aaagtggacctgcaggcagattacaacacggccaagggtgtgttgggtgccggctaccag
gccctgcggctggcacaggccttgctggcaggacaggagctgatgcttcgggggctgcac
tggttcgtagagatactccaggccacgtgcaggcggacgctggaggtcacgaggatggcc
ctcctcttcctcagcagcagcctcggcactgagaggttcagcaacatggctggggtgact
gagatccaggaactgaagagggccgcagagctgaggtccaagctgcggaccttggctgag
gtcctctccagatgttcccataatatcacagagaccaagatgaccctgagcaacctgagc
tctgagctgatgaagaaccgggatcaggtacatgaggacagaagcatccagcagattcag
tgctgtttggacaagatgtatctcatttacaaacagttcaagaaatccaggatgaggcca
gggcttggctacaatgaggagcagattcacaagctggataaggtgaattttagtcattta
gccaaaaggctcctgcaggtgttccaggaggagcgtgtgcagaagtaccaggcatccctg
gtcacgcatggcaagagaatgagggtggtgcatgagaccaggaaccacctgcgcctggtg
ggctgctccgtggccgcctgtaacacagaagcccagggagcccaggagagcctcagcaag
atccttgactggctatctcaccagctcctgcaggacagaacaaagggggctcaggcctca
ccaccccctacagctccttatcctagccctgcactgaaggacctggttctccatatgcaa
gagctctgcaaggagatgaaggtgctggcatctgacctccaggacaacaaccgcgtcatc
gaagggttaagtagggtcccatcggctcctgacatctga

DBGET integrated database retrieval system