KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_1399Help
Entry
DM39_1399         CDS       T03308                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00020  Citrate cycle (TCA cycle)
bcen00310  Lysine degradation
bcen00380  Tryptophan metabolism
bcen01100  Metabolic pathways
bcen01110  Biosynthesis of secondary metabolites
bcen01120  Microbial metabolism in diverse environments
bcen01130  Biosynthesis of antibiotics
bcen01200  Carbon metabolism
Module
bcen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcen_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcen00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM39_1399 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    DM39_1399 (sucA)
   00380 Tryptophan metabolism
    DM39_1399 (sucA)
Enzymes [BR:bcen01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     DM39_1399 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AIO33578
UniProt: A0A088U8J9
LinkDB All DBs
Position
1:1531164..1534028
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLDNPASVPENWREYFDALQNVPATDGSNAND
VAHHPIVESFAQRAKANAFIPRESGTNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEADLDQTFSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEYMYI
SDPEQKRWWQERLESIRATPNFSVDKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGKKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVITAEDADGYVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTIPENFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAFASLVASGYSVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAE
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGETDGGIDAKKVKRVLVCSGRVYY
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtcatgaagcagtttcagctgaactcctatttgttcggcggcaatgcttcg
tacgtagaagaactgtacgatgcatatctcgataatccggcgtcagtgcccgagaactgg
cgagagtatttcgacgcgttgcagaacgttcctgcaacggacggttcgaacgccaacgac
gtggcgcatcacccgatcgtcgaatcgttcgcccagcgcgccaaggccaatgccttcatc
ccgcgcgaaagcggcaccaatctggctactgcgcgcaagcaggtccacgtccagtccctc
atcagcgcctaccgcttcctcggctcgcaatgggccaatcttgatccgctgaagcgccgc
gagcgtcccgccatccccgaactcgaacctgcgttctacgacttctccgaggccgacctc
gaccagacgttcagcgcgagcaacctgtatttcggcttcgaccaggcttcgctgcgcgac
atcgtcaagggtctgcgcgacacgtattgcggcacgatcggcgccgagtacatgtacatc
agcgatccggaacagaagcgctggtggcaggagcgcctcgaatcgattcgcgcgacgccg
aacttctcggtcgacaagaagaagcacatcctgaatcgcctgacggctgcggaaggcctc
gagcgctatctgcacaccaagtacgtcggccagaagcgcttctcgctcgaaggcggcgaa
agcttcatcgcggcgatggacgaagtcgtccagcacgcgggcaagaagggcgtgcaggaa
atcgtcatcggcatggcccaccgcggccgcctgaacgtgctcgtgaacacgctcggcaag
atgccggctgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggc
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgacggaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtcaacccggtggtcgaaggttcg
gcgaaggcgcggatggaccgtcgcggcgacgaagacggcctgcaggtgctgccggtgcag
atccacggcgatgcggccttcgcgggccagggcgtcgtgatggaaacgctgaacctcgcg
cagacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtccgacccgcgcgacgcgcgctcgacgctgtactgtaccgacgtcgtcaag
atgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagccgtggtcctcgcg
acgcagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctgggtcacaacgagcaggacacgccggcggtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtacgccgagaagctcgtgcag
cagggcgtgatcaccgcggaagacgccgacggctacgtgaaggcgtaccgcaaggcgatg
gacgacggccatcacacggtcgatccggtcctgtcgaactacaagagcaagtacgcggtc
gactgggtgccgttcctgaaccgcaagtggacggacgcagccgatacggccgtgccgctc
gccgaactgaagcgcctcggcgaacgcatcacgacgatcccggaaaacttcaaggttcac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatgggcgaacacctggcattcgcgtcgctcgtcgcatcgggctactcggtg
cgcctgacgggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcat
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgccgaa
ggccaggcgaagttcactgtgatcgactcggtgctgtcggaagaggcggtgctgggcttc
gaatacggctactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gacttcgtcaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggcctgacgatgctgctgccgcacggctacgaaggccagggtccg
gagcactcgtcgacccgcatcgagcgtttcctgcagctgtgcgcggatcacaacatgcag
gtcgtccagccgacgacgccggcgcagatcttccacctgctgcgtcgccagatgatccgc
ctgttccgcaagccgctgatcgtcgcgacgccgaagtcgctgctgcgtcacaaggaagcg
gtgtcggacctgtcggaactcgcgaagggttcgttccagccggtgctgggcgaaaccgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgctggtctgctcgggccgcgtgtactac
gacctcgtcgcgcatcgccgcgaagcgaaggcgaacgacgtcgcgatcatccgtatcgaa
cagctgtatccgttcgcgcacaagcagttcgaagctgaaatgaagaagtacgagaacgcg
acggaagtggtctgggtgcaggacgagccgcagaaccagggcccctggttctacgtcgag
caccacctgaaggaaggcatgaaggaaggacagaagctggcatacagcggtcgtccggct
tcggcctcgccggcggtcggctactacgcgaagcactacgagcagcagaaggccctgatc
gaaggtgctttcggccgcctgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system