KEGG   Burkholderia cenocepacia J2315: BCAM1244
Entry
BCAM1244          CDS       T00771                                 

Definition
(GenBank) putative phosphonopyruvate decarboxylase
  KO
K09459  phosphonopyruvate decarboxylase [EC:4.1.1.82]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00440  Phosphonate and phosphinate metabolism
bcj00998  Biosynthesis of various secondary metabolites - part 2
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BCAM1244
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BCAM1244
Enzymes [BR:bcj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.82  phosphonopyruvate decarboxylase
     BCAM1244
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N
Other DBs
NCBI-ProteinID: CAR55100
UniProt: B4EHC4
LinkDB
Position
2:complement(1366982..1368163)
AA seq 393 aa
MIEAAQFVEAARERGFDWYAGVPCSYLTPFINYVLQDPTLHYVSAANEGDAVALIAGATL
GGKRGIAMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQPGVADEPQHALMGPITPAM
LDTMEIPWETFPTDPEQVGPALDRAIAHMDATGRPYALVMQKGSVAPYELKANPAAKPRA
HVAAQSASRAASTDAWPTRHDALQRVIAHTPVDSTVVLASTGFCGRELYALDDRPNQLYM
VGSMGCVTPLALGLALARPDLRVVAVDGDGAALMRMGVFATLGTYGPANLTHVLLDNGAH
ESTGGQATVSQHVSFAGVAAACGYASAVEGDTLDVLDATLAATSDGAQFVRVAIRTGVPD
GLPRPTVTPVEVKTRLMRHIGAAQTEAHVEGAH
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgatcgaagcggcccagttcgtcgaggccgcgcgcgaacgcggcttcgactggtacgcg
ggcgtaccctgctcgtacctgacgccgttcatcaattacgtgttgcaggacccgacgctg
cactacgtatcggccgccaacgaaggcgacgcggtcgcgctgatcgcgggcgcaacgctc
ggcggcaagcgcggaatcgcgatgatgcagaactccgggctcggcaacgcggtgagcccg
ctcacgtcgctgacctggacgttccgcctgccgcaactgctgatcgtcacgtggcgcggc
cagccgggcgtggccgacgagccgcagcacgcgctgatgggcccgatcacgcccgcgatg
ctcgacacgatggagatcccgtgggagacgttcccgaccgaccccgaacaggtcggcccg
gcactcgaccgcgcgatcgcgcacatggacgcgacgggccgcccgtacgcgctcgtgatg
cagaaaggcagcgtcgcgccgtatgaactgaaggcgaacccggccgcgaagccgcgtgcg
cacgtcgccgcgcaatcggcgtcgcgcgccgcatcgaccgacgcatggccgacccgtcac
gacgcgctgcagcgcgtgatcgcgcatacgccggtcgattcgaccgtcgtgctcgcgtcg
accggtttctgcggtcgcgagctctatgcgctcgacgatcgcccgaaccagctgtacatg
gtcggctcgatgggctgcgtgacgccgctcgcgctcggcctcgcgctcgcgcgccccgac
ctgcgcgtggtggccgtcgacggcgacggcgccgcgctgatgcggatgggcgtgttcgcg
acgctcggcacctacggcccggccaacctcacgcacgtgctgctcgacaacggcgcgcac
gaatcgacgggcggccaggcgacggtgtcgcaacatgtgtcgttcgccggcgtcgcggcc
gcctgcggctacgcgtcggcggtcgaaggcgatacgctcgacgtgctcgatgcgacgctc
gccgcaacgagtgacggtgcgcaattcgtccgcgtggcgatccgcactggcgtgcccgac
ggcctgccccgcccgaccgtcacgccggtcgaggtcaagacccgtctgatgcggcacatc
ggcgccgcgcagaccgaagcccacgttgaaggagcccattga

DBGET integrated database retrieval system