KEGG   Bifidobacterium dentium Bd1: BDP_0402Help
Entry
BDP_0402          CDS       T01143                                 

Definition
(GenBank) 5-formyltetrahydrofolate cyclo-ligase
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00670  One carbon pool by folate
bde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BDP_0402
Enzymes [BR:bde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     BDP_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-FTHF_cyc-lig
Motif
Other DBs
NCBI-ProteinID: ADB09079
UniProt: D2Q8E3
LinkDB All DBs
Position
complement(497456..498100)
Genome map
AA seq 214 aa AA seqDB search
MDTTEATEPPEAAERLRSMKQAMRHQAIAARKRTTPEERLEAGRRIALHACDEGLIHPFA
TVAAFVSMGSEIAMAPLLQALLDAQCRVLVPRLGSGMTIGWSELDDLEGLRSVRGDDGSP
NTRRPQEPDSPSGGPDTLSDAELIIVPAFAVDPSGIRLGRGGGWYDRALEYKAAKARVVA
ICWPWETTSTPIPHEPHDVPVDAALTPDGYMAIR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggacacgaccgaagcgaccgagcccccggaggcagccgaacgactgcgctccatgaaa
caggccatgcgccatcaggccatcgccgcacgcaaacgcaccacacccgaggaacgcctc
gaggccggccggcgcatagccctgcatgcctgtgacgaaggtctgattcaccctttcgcc
acggtggccgccttcgtttccatgggtagcgaaattgcgatggccccgctgctgcaggcg
ttgcttgacgcgcaatgccgcgtactggtgccccgattgggatccggcatgaccatcgga
tggagcgaactcgacgatctggaagggttgcgcagcgttcgcggcgatgacggttcgccg
aatacgcgccgtccgcaggaaccggatagtccctccggcgggccagacacgctcagcgat
gccgaattgatcatcgtaccggccttcgcggtggacccatccggcattcgcctaggccgt
ggcggcggctggtacgaccgcgcactggaatacaaggcggccaaggcgcgagtagtggcg
atctgctggccgtgggagaccacaagcacgccgataccgcacgagccgcacgacgttccc
gtcgatgcggcgctcaccccggacgggtacatggccattcgatga

DBGET integrated database retrieval system