KEGG   Burkholderia sp. CCGE1003: BC1003_0294
Entry
BC1003_0294       CDS       T01314                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00520  Amino sugar and nucleotide sugar metabolism
bgf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BC1003_0294
Enzymes [BR:bgf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BC1003_0294
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3 PSI_PsaJ
Other DBs
NCBI-ProteinID: ADN56298
UniProt: E1T6G5
LinkDB
Position
1:322457..323560
AA seq 367 aa
MLTGNILTTDGWIHGTLEFENGRITALTGERVDPATNDAPYILPGFIDLHVHGGGGSDVM
EAGDAIETITRTHARYGTTSLLATTMTAPRDELMSVVAGLGDVARRRTPGGSRVLGVHLE
GPYINPGKLGAQPDAAVSAVMDEVLKYLSIAPIRVVTLAPEIAGHMDIISEMAARGVRVQ
LGHSLGTYDDAVAALKHGACGFTHLFNAMSPLHHRNPGLVGAALAHAEFAEIIPDLLHVH
PGAIRAALRAIPRLYVVTDSTSATGMPDGEYRLGSQHVTKCLGGVRLADGTLAGSTLTMD
QALRNLVSIGLPIADVSNRLSRYAADYLGIEDRGRIARGAWADVVVFDRELALCATYVEG
EAIVEHA
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgctgaccggaaacatactcaccaccgacgggtggattcacggcacgctcgaattcgaa
aacggccgcattacggcgctcaccggcgagcgcgtcgatcccgcgacgaacgacgcgccg
tacatcctgccgggcttcatcgacctgcacgtgcacggcggcggcggctccgacgtaatg
gaggcgggcgacgcaatcgagaccatcacccgcacgcacgcacgctacggtacgacgagc
ctgctcgcaaccaccatgaccgcaccgcgcgacgaactgatgagcgtggtggccggtctc
ggcgacgtcgcgcgcaggcgcacgccgggcggctcgcgcgtgctcggcgtgcatctggaa
ggaccgtacatcaaccccggcaagctcggcgcgcagcccgacgcggcggtctccgcggtg
atggacgaggtgctcaagtatctgtccatcgcgccgattcgtgtggtgacgctcgcgccg
gagatcgcgggtcacatggacatcatttctgaaatggcggcgcgcggcgtgcgcgtgcag
ctcggccactcgctcggcacgtacgacgacgccgtcgccgcgctcaagcacggcgcgtgc
ggcttcacgcatctgttcaacgcgatgtcgccgctgcatcaccgcaatcccggcctcgtg
ggcgctgcgcttgcgcacgcggagttcgccgaaatcattcccgatctgctgcacgtccat
ccgggcgcgatccgcgccgcgttgcgcgcgattccgcgcctgtacgtggtgacggacagc
acgtcggcgaccggcatgcccgacggcgaataccgcctcggcagccaacacgtgacgaag
tgtctcggcggcgtgcgtctagccgacggcacgctcgccggcagcaccctgacgatggat
caggcgctgcgcaatctggtgtcgatcggtctgccgatcgccgatgtatcaaaccgtttg
tcgcgctatgccgccgactacctcggtatcgaagaccgcggccgtattgcgcgtggcgcg
tgggccgacgtcgtcgtgttcgatcgtgagctggcgctttgcgcgacctacgtcgaagga
gaagcaattgtcgaacatgcttaa

DBGET integrated database retrieval system