KEGG   Bos indicus (zebu cattle): 109574056Help
Entry
109574056         CDS       T04792                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04064  NF-kappa B signaling pathway
biu04210  Apoptosis
biu04380  Osteoclast differentiation
biu04625  C-type lectin receptor signaling pathway
biu04660  T cell receptor signaling pathway
biu04668  TNF signaling pathway
biu04672  Intestinal immune network for IgA production
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109574056 (MAP3K14)
   04064 NF-kappa B signaling pathway
    109574056 (MAP3K14)
   04668 TNF signaling pathway
    109574056 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109574056 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109574056 (MAP3K14)
   04660 T cell receptor signaling pathway
    109574056 (MAP3K14)
   04672 Intestinal immune network for IgA production
    109574056 (MAP3K14)
  09158 Development
   04380 Osteoclast differentiation
    109574056 (MAP3K14)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    109574056 (MAP3K14)
   05169 Epstein-Barr virus infection
    109574056 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109574056 (MAP3K14)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     109574056 (MAP3K14)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: STE group
  Other
   109574056 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 109574056
NCBI-ProteinID: XP_019837332
LinkDB All DBs
Position
19
AA seq 953 aa AA seqDB search
MAVMEMACPGAPGSTVGQQKEFAKAKEKTQAMGKKQSSVHKLEAVEKSPVFCGKWEILND
VITKGTAKDGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
VAHSTEGKMARVCWKGKRRSKARKKRKKKSSKSPAQAGVALAKPLPRTPEQESCTVPVQE
DEPPLGPPYVRNAPQFXKPLKEPGLGQLWFKKLGEGLRPTLPRPELHKLISPLQCLNHVW
KVHHPQDASPLPQPFPYSRLPHPFPFHPLQPWKPHPLESFFLGKLTNCVDDQQPLPGPHL
GRLACADSQKPLPSPHLKPSFPSRGSRDKLSVEEYLVHALQGSVSSGQAHSLASLAKTWS
VGGSRPQAPSPETEDSEGVLLIEKLKPVDYEYREEVHWATRQPCLGRGSFGEVHRMEDKQ
TGFQCAVKKVRVEVFRAEELMACAGLTSPRIVPLYGAVKEGPWVNIFMELLEGGSLGQLI
KQKGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSSDGSRAALCDFGHAVCL
QPNGLGKSLLTGDYIPGTETHMAPEVVMGKPCDAKVDVWSSCCMMLHMLNGCHPWTQYFR
GPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPVHRASAVELGGKVSLALQHVGGL
RSPWRGEYKEPRHPLPLQDHPPPSQGHRQRTLHAPPGELSPGAXXXQPAKDAAGGAPKLQ
PPPPPDPPEQSKSPSLHWGKEESGTWDPLPLSSLDPAPARNPTSPERKATFPEQELQQLE
IELFLNSLSQPFSLEEQEQILSCLSVDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQ
AEARSSSWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQI
PAAAFSLVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaatggcctgcccaggcgcccccggctccacggtcgggcagcagaag
gagttcgccaaagccaaggagaagacacaggcgatggggaagaagcagagctccgtccac
aagctggaggccgtggagaagagccccgtgttctgcgggaagtgggagatcctgaacgac
gtgatcaccaaaggcacagccaaggacggctcggaggctgggccagctgccatctccatc
atcgcccaggccgaatgtgagaacagccaagagttcagccccaccttttcagaacggatc
ttcatcgctggttcgaaacagtacagccagtccgagagtcttgatcagatccccaacaat
gtggcccactcgactgagggcaaaatggcccgtgtgtgctggaaggggaagcgccgcagc
aaagcccggaagaaacgcaagaagaagagctccaagtccccggctcaggcgggggtggcc
ttggccaaacccctccccaggacccccgagcaggagagctgcacggtcccagtgcaggaa
gatgagcctccactgggtcccccatatgttagaaatgccccgcagttcrccaagcctctg
aaggagccgggccttggtcagctctggtttaagaagcttggggagggcctgcggccaacg
ctgcctcgaccagaactccacaaactgatcagccccctgcagtgtctgaaccacgtgtgg
aaagtccaccacccacaggacgccagccccctgccccagcccttcccctacagcaggctg
cctcaccccttcccattccaccctctccagccctggaagcctcacccgctagagtccttc
ttccttggcaaactgacaaactgtgtagacgaccagcagcccctgcctggccctcacctg
ggcagactggcctgtgcagatagccagaagcccctgcccagccctcacctgaagcccagc
ttcccgtctcgtggctcaagggacaagctgtccgtggaggagtacctggtacatgccttg
caaggcagcgtgagctccggccaggcccacagcctggccagcctggccaagacctggtca
gtggggggctccaggccccaggcgcccagccccgaaactgaggacagcgagggggtccta
ctcatcgagaaactcaagccggtggattatgagtaccgagaggaggtccactgggccacg
cgccagccctgcctgggcagaggctcctttggagaggtccacaggatggaggacaagcag
accggcttccagtgtgccgtcaaaaaggtgcgagttgaagtatttcgggcagaggagttg
atggcatgtgcgggaytgacctcccccagaatcgtccctttgtatggagctgtgaaggaa
gggccttgggtcaacatcttcatggaactgctggaaggtggttcgctaggccagctcata
aagcagaaaggctgtctgccagaggaccgggccctttactacctgggccaggcgctggaa
gggctggaatacctccatacccgcaggattctacatggagatgtgaaagccgacaacgtg
ctcctgtccagcgatgggagccgcgcagccctctgcgactttggccacgctgtgtgcctt
cagcccaacggcctggggaagtctttgctcacaggggactacatccccgggacagagacc
cacatggcgccagaggtggtgatgggcaagccctgcgatgccaaggtggacgtctggagc
agctgttgtatgatgctgcacatgctcaacggctgccacccctggacccagtacttccga
ggaccgctctgcctcaagattgccagtgagcctccacctgtgagggagatcccgccctcc
tgtgccccgctcacggcccaggccatccaggaggggctcaggaaagagccggtccaccga
gcatctgcagtggagctgggggggaaggtcagcctggcactgcagcacgtgggaggtctg
aggagtccctggagaggagagtacaaagaaccaagacatccactgccactccaagaccac
ccaccaccaagccaaggccaccgtcagcggaccctgcatgccccgccaggggagctctca
ccaggggcnnnnnnnnngcagccagctaaggacgcagcaggcggggcccctaagctccag
cctcctccacctccagaccccccagagcagagcaagtctcccagcctgcactggggcaag
gaggagtctgggacatgggacccactgcccctgtcctccctggatcctgcccccgccagg
aaccccacctcacccgagcgaaaggcaacctttcctgaacaggagctacagcagctggag
atagagttatttctgaacagcctgtcccagccgttctccctggaggagcaggagcagatc
ctctcgtgcctcagcgtcgacagcctctccctgtcagatgacagtgagaagaacccgtcc
aaggcttctcagagctcgcgggacacactgagttccggcgtgcattcgtggagcagccag
gcagaggcccgcagctccagctggaacatggtgctggcccgggggcggcccactgacaca
ccaagctatttcaacggtgtgaaagtccaaatacagtctctcaatggcgaacacctgcac
atccgggagttccaccgggtcaaggtgggagacatcgcaacaggcatcagcagccagatc
ccagctgcagccttcagcttggtgaccaaggacgggcagcccgtgcgctacgacatggag
gtgccggactcaggcatcgacctgcagtgcaccctggccccagacggcagcttcgcttgg
agctggagggtcaagcacggccagctggagaacaggccctaa

DBGET integrated database retrieval system