KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1586Help
Entry
BBMN68_1586       CDS       T01345                                 

Definition
(GenBank) 5-formyltetrahydrofolate cyclo-ligase
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
blb00670  One carbon pool by folate
blb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BBMN68_1586
Enzymes [BR:blb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     BBMN68_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-FTHF_cyc-lig
Motif
Other DBs
NCBI-ProteinID: ADQ02624
LinkDB All DBs
Position
complement(1983008..1983748)
Genome map
AA seq 246 aa AA seqDB search
MSEADNGMNIGSDHSGTEKTEKMDKATLRHHILSRRKRIPAEERGAAGELLVRRFPAHMI
QDGSTVAAYVSMGSEIETRPLLRWLLAHGCHVLVPRLGSGLEIGWSVLDSLESLRSMDAV
GGANNAGSCSSPSTVHHRPDEPTGAVLPPEALEKADLVIAPALAVDPQGNRLGRGAGWYD
RALARRKPACPLIAVCWPWEVLDIDLPAEPHDVPADGVLTPEGYRRLSSSGLLSWPAGQD
TRRKPD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcggacaatggcatgaatatcggcagcgaccacagcggcacggagaaaaca
gaaaagatggataaagcgacgctgcgccaccatatactgtctcggcgcaagcgcattcca
gcggaagaacgtggagcggccggtgaattgctggtgcgacggttcccggcacacatgatt
caggatggttccacagtggcggcatatgtgtcgatgggttcggaaatcgaaacccggcca
ctgttgcgatggctgttggctcatggctgccacgtgttggtgccacgattgggatctggg
ttggaaattggctggagtgtgctggattcattggaatccttgcgctcgatggatgcagtg
ggtggcgcgaacaatgccggtagctgcagctctcccagcaccgtccatcacagacccgat
gagccaactggcgcagttctaccgcccgaagcgttggagaaggccgatctggtcatcgct
ccggctttggcagtggacccgcagggcaatcgtctggggcgtggagccggctggtatgac
cgggccttggctcgccgcaagcccgcatgtcccctgattgcggtgtgctggccgtgggag
gtgttggacattgatttgccggccgaaccacatgatgtgccggccgacggagtgctgacg
ccggagggataccggcggcttagctcatcgggcctgttgagctggccggccggccaagat
actcggcgcaagccagactga

DBGET integrated database retrieval system