KEGG   Bos mutus (wild yak): 102272045
Entry
102272045         CDS       T02919                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04672  Intestinal immune network for IgA production
bom05140  Leishmaniasis
bom05200  Pathways in cancer
bom05310  Asthma
bom05320  Autoimmune thyroid disease
bom05321  Inflammatory bowel disease
bom05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272045 (IL4)
   04151 PI3K-Akt signaling pathway
    102272045 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102272045 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102272045 (IL4)
   04660 T cell receptor signaling pathway
    102272045 (IL4)
   04658 Th1 and Th2 cell differentiation
    102272045 (IL4)
   04659 Th17 cell differentiation
    102272045 (IL4)
   04657 IL-17 signaling pathway
    102272045 (IL4)
   04664 Fc epsilon RI signaling pathway
    102272045 (IL4)
   04672 Intestinal immune network for IgA production
    102272045 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102272045 (IL4)
  09163 Immune disease
   05310 Asthma
    102272045 (IL4)
   05320 Autoimmune thyroid disease
    102272045 (IL4)
   05321 Inflammatory bowel disease
    102272045 (IL4)
   05330 Allograft rejection
    102272045 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102272045 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272045 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102272045 (IL4)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102272045 (IL4)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Haparin
  Cytokines
   102272045 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 102272045
NCBI-ProteinID: XP_005888424
UniProt: L8J2E0
LinkDB
Position
Un
AA seq 135 aa
MGLTSQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAP
KNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDL
LERLKTIMKEKYSKC
NT seq 408 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccagctgatcccagtgctggtctgcttactggtatgtaccagtcac
ttcgtccatggacacaagtgtgatattaccttagcagagatcatcaaaacgctgaacatc
ctcacaacgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca
aagaacacaactgagaaggaaaccttctgcagggttggaattgagcttaggcgtatttac
aggagccacacgtgcttgaacaaattcctgggcggacttgacaggaatctcaacagcttg
gcaagcaagacctgttctgtgaatgaagccaagacgagcacaagtacgctgaaagacctc
ttggaaaggctaaagacgattatgaaggagaaatactccaagtgttga

DBGET integrated database retrieval system