Bos mutus (wild yak): 102272045 Help Entry 102272045         CDS       T02919                                  Symbol IL4 Name (RefSeq) interleukin 4   KO K05430   interleukin 4 Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04151   PI3K-Akt signaling pathway bom04630   JAK-STAT signaling pathway bom04640   Hematopoietic cell lineage bom04657   IL-17 signaling pathway bom04658   Th1 and Th2 cell differentiation bom04659   Th17 cell differentiation bom04660   T cell receptor signaling pathway bom04664   Fc epsilon RI signaling pathway bom04672   Intestinal immune network for IgA production bom05140   Leishmaniasis bom05200   Pathways in cancer bom05310   Asthma bom05320   Autoimmune thyroid disease bom05321   Inflammatory bowel disease bom05330   Allograft rejection Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102272045 (IL4)    04151 PI3K-Akt signaling pathway     102272045 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102272045 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102272045 (IL4)    04660 T cell receptor signaling pathway     102272045 (IL4)    04658 Th1 and Th2 cell differentiation     102272045 (IL4)    04659 Th17 cell differentiation     102272045 (IL4)    04657 IL-17 signaling pathway     102272045 (IL4)    04664 Fc epsilon RI signaling pathway     102272045 (IL4)    04672 Intestinal immune network for IgA production     102272045 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102272045 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102272045 (IL4)   09163 Immune disease    05310 Asthma     102272045 (IL4)    05320 Autoimmune thyroid disease     102272045 (IL4)    05321 Inflammatory bowel disease     102272045 (IL4)    05330 Allograft rejection     102272045 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102272045 (IL4)    00536 Glycosaminoglycan binding proteins [BR:bom00536]     102272045 (IL4) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Interleukins    102272045 (IL4) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Cytokines    102272045 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  102272045 NCBI-ProteinID:  XP_005888424 UniProt:  L8J2E0 LinkDB All DBs Position Un AA seq 135 aa AA seqDB search MGLTSQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAP KNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDL LERLKTIMKEKYSKC NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccagctgatcccagtgctggtctgcttactggtatgtaccagtcac ttcgtccatggacacaagtgtgatattaccttagcagagatcatcaaaacgctgaacatc ctcacaacgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca aagaacacaactgagaaggaaaccttctgcagggttggaattgagcttaggcgtatttac aggagccacacgtgcttgaacaaattcctgggcggacttgacaggaatctcaacagcttg gcaagcaagacctgttctgtgaatgaagccaagacgagcacaagtacgctgaaagacctc ttggaaaggctaaagacgattatgaaggagaaatactccaagtgttga

DBGET integrated database retrieval system