KEGG   Bos mutus (wild yak): 102272370
Entry
102272370         CDS       T02919                                 

Gene name
TP53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04010  MAPK signaling pathway
bom04071  Sphingolipid signaling pathway
bom04110  Cell cycle
bom04115  p53 signaling pathway
bom04137  Mitophagy - animal
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04216  Ferroptosis
bom04218  Cellular senescence
bom04310  Wnt signaling pathway
bom04722  Neurotrophin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom05012  Parkinson disease
bom05014  Amyotrophic lateral sclerosis
bom05016  Huntington disease
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05216  Thyroid cancer
bom05217  Basal cell carcinoma
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102272370 (TP53)
   04310 Wnt signaling pathway
    102272370 (TP53)
   04071 Sphingolipid signaling pathway
    102272370 (TP53)
   04151 PI3K-Akt signaling pathway
    102272370 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102272370 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    102272370 (TP53)
   04210 Apoptosis
    102272370 (TP53)
   04216 Ferroptosis
    102272370 (TP53)
   04115 p53 signaling pathway
    102272370 (TP53)
   04218 Cellular senescence
    102272370 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102272370 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102272370 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    102272370 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102272370 (TP53)
   05202 Transcriptional misregulation in cancer
    102272370 (TP53)
   05206 MicroRNAs in cancer
    102272370 (TP53)
   05205 Proteoglycans in cancer
    102272370 (TP53)
   05203 Viral carcinogenesis
    102272370 (TP53)
   05230 Central carbon metabolism in cancer
    102272370 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102272370 (TP53)
   05212 Pancreatic cancer
    102272370 (TP53)
   05225 Hepatocellular carcinoma
    102272370 (TP53)
   05226 Gastric cancer
    102272370 (TP53)
   05214 Glioma
    102272370 (TP53)
   05216 Thyroid cancer
    102272370 (TP53)
   05220 Chronic myeloid leukemia
    102272370 (TP53)
   05217 Basal cell carcinoma
    102272370 (TP53)
   05218 Melanoma
    102272370 (TP53)
   05219 Bladder cancer
    102272370 (TP53)
   05215 Prostate cancer
    102272370 (TP53)
   05213 Endometrial cancer
    102272370 (TP53)
   05224 Breast cancer
    102272370 (TP53)
   05222 Small cell lung cancer
    102272370 (TP53)
   05223 Non-small cell lung cancer
    102272370 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102272370 (TP53)
   05014 Amyotrophic lateral sclerosis
    102272370 (TP53)
   05016 Huntington disease
    102272370 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102272370 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102272370 (TP53)
   05161 Hepatitis B
    102272370 (TP53)
   05160 Hepatitis C
    102272370 (TP53)
   05162 Measles
    102272370 (TP53)
   05168 Herpes simplex virus 1 infection
    102272370 (TP53)
   05163 Human cytomegalovirus infection
    102272370 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102272370 (TP53)
   05169 Epstein-Barr virus infection
    102272370 (TP53)
   05165 Human papillomavirus infection
    102272370 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102272370 (TP53)
   01522 Endocrine resistance
    102272370 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102272370 (TP53)
   03036 Chromosome and associated proteins [BR:bom03036]
    102272370 (TP53)
   03400 DNA repair and recombination proteins [BR:bom03400]
    102272370 (TP53)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102272370 (TP53)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102272370 (TP53)
DNA repair and recombination proteins [BR:bom03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102272370 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD DEC-1_N
Other DBs
NCBI-GeneID: 102272370
NCBI-ProteinID: XP_005894864
UniProt: L8IPI8
LinkDB
Position
Un
AA seq 386 aa
MEESQAELNVEPPLSQETFSDLWNLLPENNLLSSELSAPVDDLLPYTDVATWLDECPNEA
PQMPEPSAPAAPPPATPAPATSWPLSSFVPSQKTYPGNYGFRLGFLHSGTAKSVTCTYSP
SLNKLFCQLAKTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDG
LAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYESPEIDSECTTIHYNFMCNSSCMGGMN
RRPILTIITLEDSCGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGQSCPEPPPRSTKRA
LPTNTSSSPQPKKKPLDGEYFTLQIRGFKRYEMFRELNDALELKDALDGREPGESRAHSS
HLKSKKRPSPSCHKKPMLKREGPDSD
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggaagaatcgcaggcagaactcaatgtggagccccctctgagtcaggagacattttcc
gacttgtggaacctacttcctgaaaataaccttctgtcctccgagctctccgcacccgtg
gatgacctgctcccgtacacagatgttgccacctggctggatgaatgtccgaatgaagcg
ccccaaatgccagagccttctgccccagctgccccgccaccagccaccccagcaccagcc
acctcctggcccctgtcgtcatttgtcccctcccagaagacctaccctggcaattacggt
ttccgtctagggttcctgcattccggaacagccaagtccgtgacctgcacgtattcccct
tcccttaacaagctgttctgccagctggccaagacctgcccagtgcagctgtgggtcgac
tcgccacccccgcccggcacccgcgtccgcgccatggccatctacaagaagttggagcac
atgacggaggttgtgaggcgttgtccccaccatgagcgctcctctgactatagcgatggt
ctggcccctcctcagcaccttatccgggtggaagggaatttacgcgcggagtatttggac
gaccggaacacctttagacacagtgtggtggtgccctatgagtcccccgagatcgactct
gagtgcaccaccatccactacaatttcatgtgtaacagctcctgcatggggggcatgaac
cggcggcccatcctcaccatcatcacactggaagactcttgtggtaacctgctgggacgg
aacagctttgaggtgcgtgtttgtgcctgtcctgggagagaccgccgcactgaggaagaa
aatcttcgcaagaaggggcagtcttgccccgagccaccccctaggagcactaagcgagca
ctgcctaccaacaccagctcctctccacagccaaagaagaaaccactggatggagagtac
ttcactcttcagatccgtgggtttaaacgctatgagatgttccgagagctgaatgacgcc
ttggagctgaaggatgctctggatggaagggaaccaggggaaagcagggctcactctagc
cacctgaagtctaagaagaggccttctccctcctgccataaaaaaccaatgctcaagaga
gaggggcctgactcagactga

DBGET integrated database retrieval system