Bos mutus (wild yak): 102272370 Help Entry 102272370         CDS       T02919                                  Symbol TP53 Name (RefSeq) tumor protein p53   KO K04451   tumor protein p53 Organism bom  Bos mutus (wild yak) Pathway bom01522   Endocrine resistance bom01524   Platinum drug resistance bom04010   MAPK signaling pathway bom04071   Sphingolipid signaling pathway bom04110   Cell cycle bom04115   p53 signaling pathway bom04137   Mitophagy - animal bom04151   PI3K-Akt signaling pathway bom04210   Apoptosis bom04211   Longevity regulating pathway bom04216   Ferroptosis bom04218   Cellular senescence bom04310   Wnt signaling pathway bom04722   Neurotrophin signaling pathway bom04919   Thyroid hormone signaling pathway bom05012   Parkinson disease bom05014   Amyotrophic lateral sclerosis bom05016   Huntington disease bom05160   Hepatitis C bom05161   Hepatitis B bom05162   Measles bom05163   Human cytomegalovirus infection bom05165   Human papillomavirus infection bom05166   Human T-cell leukemia virus 1 infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05200   Pathways in cancer bom05202   Transcriptional misregulation in cancer bom05203   Viral carcinogenesis bom05205   Proteoglycans in cancer bom05206   MicroRNAs in cancer bom05210   Colorectal cancer bom05212   Pancreatic cancer bom05213   Endometrial cancer bom05214   Glioma bom05215   Prostate cancer bom05216   Thyroid cancer bom05217   Basal cell carcinoma bom05218   Melanoma bom05219   Bladder cancer bom05220   Chronic myeloid leukemia bom05222   Small cell lung cancer bom05223   Non-small cell lung cancer bom05224   Breast cancer bom05225   Hepatocellular carcinoma bom05226   Gastric cancer bom05230   Central carbon metabolism in cancer bom05417   Lipid and atherosclerosis bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102272370 (TP53)    04310 Wnt signaling pathway     102272370 (TP53)    04071 Sphingolipid signaling pathway     102272370 (TP53)    04151 PI3K-Akt signaling pathway     102272370 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102272370 (TP53)   09143 Cell growth and death    04110 Cell cycle     102272370 (TP53)    04210 Apoptosis     102272370 (TP53)    04216 Ferroptosis     102272370 (TP53)    04115 p53 signaling pathway     102272370 (TP53)    04218 Cellular senescence     102272370 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     102272370 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     102272370 (TP53)   09149 Aging    04211 Longevity regulating pathway     102272370 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102272370 (TP53)    05202 Transcriptional misregulation in cancer     102272370 (TP53)    05206 MicroRNAs in cancer     102272370 (TP53)    05205 Proteoglycans in cancer     102272370 (TP53)    05203 Viral carcinogenesis     102272370 (TP53)    05230 Central carbon metabolism in cancer     102272370 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     102272370 (TP53)    05212 Pancreatic cancer     102272370 (TP53)    05225 Hepatocellular carcinoma     102272370 (TP53)    05226 Gastric cancer     102272370 (TP53)    05214 Glioma     102272370 (TP53)    05216 Thyroid cancer     102272370 (TP53)    05220 Chronic myeloid leukemia     102272370 (TP53)    05217 Basal cell carcinoma     102272370 (TP53)    05218 Melanoma     102272370 (TP53)    05219 Bladder cancer     102272370 (TP53)    05215 Prostate cancer     102272370 (TP53)    05213 Endometrial cancer     102272370 (TP53)    05224 Breast cancer     102272370 (TP53)    05222 Small cell lung cancer     102272370 (TP53)    05223 Non-small cell lung cancer     102272370 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102272370 (TP53)    05161 Hepatitis B     102272370 (TP53)    05160 Hepatitis C     102272370 (TP53)    05162 Measles     102272370 (TP53)    05168 Herpes simplex virus 1 infection     102272370 (TP53)    05163 Human cytomegalovirus infection     102272370 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     102272370 (TP53)    05169 Epstein-Barr virus infection     102272370 (TP53)    05165 Human papillomavirus infection     102272370 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     102272370 (TP53)    05014 Amyotrophic lateral sclerosis     102272370 (TP53)    05016 Huntington disease     102272370 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102272370 (TP53)    05418 Fluid shear stress and atherosclerosis     102272370 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102272370 (TP53)    01522 Endocrine resistance     102272370 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bom03000]     102272370 (TP53)    03036 Chromosome and associated proteins [BR:bom03036]     102272370 (TP53)    03400 DNA repair and recombination proteins [BR:bom03400]     102272370 (TP53) Transcription factors [BR:bom03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     102272370 (TP53) Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      102272370 (TP53) DNA repair and recombination proteins [BR:bom03400]  Eukaryotic type   Check point factors    Other check point factors     102272370 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD DEC-1_N Motif Other DBs NCBI-GeneID:  102272370 NCBI-ProteinID:  XP_005894864 UniProt:  L8IPI8 LinkDB All DBs Position Un AA seq 386 aa AA seqDB search MEESQAELNVEPPLSQETFSDLWNLLPENNLLSSELSAPVDDLLPYTDVATWLDECPNEA PQMPEPSAPAAPPPATPAPATSWPLSSFVPSQKTYPGNYGFRLGFLHSGTAKSVTCTYSP SLNKLFCQLAKTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDG LAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYESPEIDSECTTIHYNFMCNSSCMGGMN RRPILTIITLEDSCGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGQSCPEPPPRSTKRA LPTNTSSSPQPKKKPLDGEYFTLQIRGFKRYEMFRELNDALELKDALDGREPGESRAHSS HLKSKKRPSPSCHKKPMLKREGPDSD NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt atggaagaatcgcaggcagaactcaatgtggagccccctctgagtcaggagacattttcc gacttgtggaacctacttcctgaaaataaccttctgtcctccgagctctccgcacccgtg gatgacctgctcccgtacacagatgttgccacctggctggatgaatgtccgaatgaagcg ccccaaatgccagagccttctgccccagctgccccgccaccagccaccccagcaccagcc acctcctggcccctgtcgtcatttgtcccctcccagaagacctaccctggcaattacggt ttccgtctagggttcctgcattccggaacagccaagtccgtgacctgcacgtattcccct tcccttaacaagctgttctgccagctggccaagacctgcccagtgcagctgtgggtcgac tcgccacccccgcccggcacccgcgtccgcgccatggccatctacaagaagttggagcac atgacggaggttgtgaggcgttgtccccaccatgagcgctcctctgactatagcgatggt ctggcccctcctcagcaccttatccgggtggaagggaatttacgcgcggagtatttggac gaccggaacacctttagacacagtgtggtggtgccctatgagtcccccgagatcgactct gagtgcaccaccatccactacaatttcatgtgtaacagctcctgcatggggggcatgaac cggcggcccatcctcaccatcatcacactggaagactcttgtggtaacctgctgggacgg aacagctttgaggtgcgtgtttgtgcctgtcctgggagagaccgccgcactgaggaagaa aatcttcgcaagaaggggcagtcttgccccgagccaccccctaggagcactaagcgagca ctgcctaccaacaccagctcctctccacagccaaagaagaaaccactggatggagagtac ttcactcttcagatccgtgggtttaaacgctatgagatgttccgagagctgaatgacgcc ttggagctgaaggatgctctggatggaagggaaccaggggaaagcagggctcactctagc cacctgaagtctaagaagaggccttctccctcctgccataaaaaaccaatgctcaagaga gaggggcctgactcagactga

DBGET integrated database retrieval system