KEGG   Bipolaris oryzae: COCMIDRAFT_97017Help
Entry
COCMIDRAFT_97017  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bor  Bipolaris oryzae
Pathway
bor00010  Glycolysis / Gluconeogenesis
bor00051  Fructose and mannose metabolism
bor00052  Galactose metabolism
bor00500  Starch and sucrose metabolism
bor00520  Amino sugar and nucleotide sugar metabolism
bor01100  Metabolic pathways
bor01110  Biosynthesis of secondary metabolites
bor01130  Biosynthesis of antibiotics
bor01200  Carbon metabolism
Module
bor_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bor_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCMIDRAFT_97017
   00051 Fructose and mannose metabolism
    COCMIDRAFT_97017
   00052 Galactose metabolism
    COCMIDRAFT_97017
   00500 Starch and sucrose metabolism
    COCMIDRAFT_97017
   00520 Amino sugar and nucleotide sugar metabolism
    COCMIDRAFT_97017
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    COCMIDRAFT_97017
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bor04131]
    COCMIDRAFT_97017
Enzymes [BR:bor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     COCMIDRAFT_97017
Membrane trafficking [BR:bor04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    COCMIDRAFT_97017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 19128969
NCBI-ProteinID: XP_007688613
JGI: Cocmi1_97017
UniProt: W6YZX8
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MTTVLGSMADMPRDLKEQIEKLEEQFVVSTEKIKHISDHFVSELEKGLSEQGGSIPMIPT
WCMAFPDGNETGKYLALDMGGTNLRVCEVTLTEEKGEFEIIQSKYRMPEELKTGTADELW
GYVADCLQQFIEYHHEGEQLADLPLGFTFSYPVSQDAIDHGVLQRWTKGFDVQGVEGVDV
VPGFKAALEERGVPIKLAALVNDTTGTMIASAYTDTSIKIGCIFGTGCNAAYMEECGAIP
KLKHMNLDPKLPMAINCEWGAFDNEHQVLPRTKYDVIIDKESPRPGQQTFEKMVAGLYLG
EIFRLVLLDLHKGTECSMFEGQNASKLDKPYSLDAGFLSQIEEDRFENLQDTADLFQETL
GITCTKPELELIRRLAELIGTRAARLTACGVSAICKHKKWSEVHVGADGSVFSKYPHFKI
RQAQALKEIMDWPAKYGKGKNDPIEVLPAEDGSGVGAALIAALTVKRAQQGQLAGIRDQD
ALLAMGKTNKK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgtgttaggctcaatggcggacatgccccgggatctgaaggagcagatcgag
aagctggaggagcagtttgtcgtctccacggaaaagattaagcacatctcggatcacttt
gttagtgagctggagaagggactatcagagcaaggcggaagcattcctatgatcccgact
tggtgcatggcctttcccgatggcaacgagaccggaaaatatcttgcgcttgacatgggc
ggtacgaacctacgtgtttgtgaggttaccctgacggaagagaagggagagtttgagatc
atacaatcaaagtaccgtatgcccgaggagctgaagactggaactgccgatgagctatgg
ggctatgtcgccgactgcctccagcaattcatcgaataccaccacgagggcgagcagctc
gccgatcttcctctcggtttcaccttctcgtaccctgtctcgcaagatgctattgaccac
ggtgtcctacagcgatggaccaagggattcgacgtacaaggcgtggagggtgtagacgtt
gtgcctggattcaaggcagccctggaggaacgcggcgtgcctatcaaactcgcagcgctg
gtcaacgacactaccggtaccatgattgcctcagcgtataccgataccagcatcaagatt
ggttgcatcttcggtacggggtgtaacgctgcctacatggaggagtgtggtgctattccc
aagctgaagcacatgaacctggacccaaaactaccaatggctatcaactgcgaatggggc
gcctttgacaacgaacaccaagttctaccacggacaaagtacgatgttataattgacaag
gagtcgcctcggccgggtcaacagacttttgaaaagatggttgcaggtctgtaccttggc
gagatcttccgtctagtcctcttggatcttcacaagggtacagaatgctccatgttcgaa
ggccagaatgccagcaagctcgacaagccttactctcttgatgctggtttcctctctcag
atcgaagaagaccgcttcgagaatttgcaagatacggccgatctgttccaggagacactt
ggtatcacatgcactaagcctgaactcgagctcatccgtcgacttgctgagttgattggt
acccgcgctgctcgtctgactgcctgtggtgtctccgctatctgcaagcacaagaaatgg
agcgaggtacatgttggcgctgacggctccgtattcagcaagtatcctcacttcaagatt
cgtcaagctcaggcactgaaggaaattatggactggccagccaagtacggaaagggcaag
aacgatcctattgaggtgctacctgccgaggacggttccggtgttggtgctgcgctcatt
gctgcgcttacggtcaagcgtgcgcaacagggacaactggctggtatcagggaccaggat
gcgctgcttgctatgggaaagaccaacaagaaatag

DBGET integrated database retrieval system