KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_08089Help
Entry
BSNT_08089        CDS       T02607                                 

Gene name
prkC
Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Brite
KEGG Orthology (KO) [BR:bso00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bso01001]
    BSNT_08089 (prkC)
Enzymes [BR:bso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BSNT_08089 (prkC)
Protein kinases [BR:bso01001]
 Serine/threonine kinases: Other
  Bacterial family
   BSNT_08089 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo Haspin_kinase RIO1 Seadorna_VP7 Pkinase_fungal PBP1_TM
Motif
Other DBs
NCBI-ProteinID: BAI85204
UniProt: D4FWH3
LinkDB All DBs
Position
1661753..1663699
Genome map
AA seq 648 aa AA seqDB search
MLIGKRISGRYQILRVIGGGGMANVYLAEDIILDREVAIKILRFDYANDNEFIRRFRREA
QSASSLDHPNIVSIYDLGEEDDIYYIVMEYVEGMTLKEYITANGPLHPKEALNIMEQIVS
AIAHAHQNQIVHRDIKPHNILIDHMGNIKVTDFGIATALSSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGRIPFDGESAVSIALKHLQAETPSAKRWNPSVPQS
VENIILKATAKDPFHRYETAEDMEADIKTAFDADRLNEKRFTIQEDEEMTKAIPIIKDEE
LAKAAGEKEAEVTTAQENKTKKNGKRKKWPWVLLTICLVFITAGILAVTVFPSLFMPKDV
KIPDVSGMEYEKAAGLLEKEGLQVDSELLEISDEKIEEGLMVKTDPKADTTVKEGATVTL
YKSTGKAKTEIGDVTGQTVDQAKKALKDQGFKHVTVNEVNDEKNAGTVIDQNPSAGTELV
PSEDQVKLTVSIGPEDITLRDLKTYSKEAASGYLEDNGLKLVEKEAYSDDVPEGQVVKQK
PAAGTAVKPGNEVEVTFSLGPEKKPAKTVKEKVKIPYEPENEGDELQVQIAVDDADHSIS
DTYEEFKIKEPTERTIELKIEPGQKGYYQVMVNNKVVSYKTIEYPKDE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatcggcaagcggatcagcgggcgttaccaaattctccgcgttataggcggcggg
ggaatggccaacgtgtatttagctgaggatatcattctagaccgtgaagtcgcaattaaa
atcctgcggtttgactatgcaaatgacaatgaatttatcagacgtttccgcagagaagcc
caatccgcatcaagcctcgatcacccgaatattgtcagcatttacgatttgggcgaggaa
gatgatatttattatattgtcatggaatacgttgaaggcatgacgcttaaagaatacata
acagcaaatgggccacttcaccctaaagaagcgctgaacatcatggagcaaatagtctca
gccatcgctcatgcccatcaaaaccagattgttcacagagacatcaagccgcataacatt
ttgattgatcatatgggaaatatcaaagtaacggattttggaattgcgacggcactaagt
tcgaccacaatcacccataccaattcagttctgggctcggtccattacttatcacctgaa
caggcccggggcggcttagccacaaagaaatcggatatttatgcgcttggaatcgttcta
tttgagcttttaaccggccgtattccgtttgatggagagtcagcagtcagcatcgccttg
aagcatcttcaagcggaaactccttcggcaaaaaggtggaatccatcggtcccccaaagc
gttgaaaacatcatactcaaggcaactgccaaagatccttttcatcgctacgaaacggct
gaagacatggaagcagacataaaaacagcttttgatgccgacagactcaatgaaaagaga
tttacgattcaagaagatgaagaaatgacaaaagcgatacctatcattaaagatgaagaa
ctcgctaaagctgctggcgaaaaagaagctgaagtgacaaccgcacaagaaaacaaaaca
aagaagaacggtaaaagaaaaaagtggccgtgggttttgctcacgatatgcctcgttttt
atcacagctggaattcttgctgtcactgtttttccgtcgcttttcatgcctaaggatgtc
aaaatacctgatgtctccggaatggaatacgaaaaagccgcagggctcttggaaaaagaa
ggtttacaggttgattccgagttgttggaaatctcagatgaaaaaattgaagagggcctg
atggtaaaaacggatcctaaagcggataccacagtcaaagaaggcgccacggtcaccctt
tataagagcaccggaaaagcaaaaacggagatcggtgatgtgacaggccaaacggtcgac
caggcaaaaaaagcgttgaaggaccaagggtttaaacatgtaacagtaaatgaagtgaat
gacgagaaaaatgcgggcactgtcattgaccaaaatccttcagcagggactgagcttgtc
ccgagtgaagatcaagtcaaacttacagtcagtatcggacccgaagacattacgcttaga
gacttgaaaacctatagtaaagaagcagcgtctggatatctggaagacaacggattgaag
cttgtagaaaaagaagcatactcagatgatgttccagaaggacaggttgtcaaacaaaaa
ccagcagcaggtacggcagtaaagccgggaaacgaagttgaagtgacattctctctcgga
ccagagaaaaaacctgcgaaaacagtgaaagaaaaggtcaagatcccctacgaaccagaa
aatgaaggggacgagcttcaagtgcaaatcgcggttgacgatgcggatcacagcatctct
gacacttacgaagaatttaagataaaagagccgactgaacgaacgatcgaactaaagatt
gaacccggccaaaaagggtactatcaagtaatggtaaacaataaagttgtcagctacaaa
accattgagtatccgaaagatgaataa

DBGET integrated database retrieval system