KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_10837
Entry
BSNT_10837        CDS       T02607                                 

Symbol
yhcD
Name
(GenBank) hypothetical protein
Organism
bso  Bacillus subtilis subsp. natto BEST195
SSDB
Other DBs
NCBI-ProteinID: BAP05627
UniProt: A0A068PC97
LinkDB
Position
959292..959447
AA seq 51 aa
MKKANPFTHAGLPFLLFPSIMFLSNKSMEYVVFHLDLVYYVTHTPRIFSGR
NT seq 156 nt   +upstreamnt  +downstreamnt
atgaaaaaggcaaatccgtttactcatgcgggtttgccttttttgctgtttccatcaatt
atgtttttatcaaataaatccatggaatatgttgtattccatcttgatctagtgtactat
gttactcatacaccgaggattttttccgggaggtaa

DBGET integrated database retrieval system