KEGG   Bombus terrestris (buff-tailed bumblebee): 100643680
Entry
100643680         CDS       T04364                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:bter00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100643680
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100643680
NCBI-ProteinID: XP_003393975
LinkDB
AA seq 164 aa
MDMKSKCNTDSNSDTNQNISGNREATSERSRARLMMQYPNIDIQEGRRLRSVRRRLFQDE
DDDNETESVRNSGVEDNCFFEETRKNRENAKERWNFDFEKEEPLPGRYVWVKLDQHGNEI
CNPSETKNRIENLQTMQEEDVQDDDITMQDHVEGKDDEKLTDST
NT seq 495 nt   +upstreamnt  +downstreamnt
atggatatgaagtcaaaatgcaatacggattcgaattcggatacaaaccagaatatctcc
ggaaatcgagaagcaacgagcgaacgatccagggctcgactcatgatgcaatatccaaac
atcgatatacaagagggaagaagactccgtagcgtacgaagaagactttttcaagacgaa
gacgatgataacgaaacggaatcggtacgaaattctggtgtcgaggacaactgttttttt
gaagagacacgaaaaaatcgagaaaacgctaaggaaagatggaatttcgacttcgagaaa
gaagaacctctacctggtcgttatgtatgggtgaaacttgaccagcacggaaatgaaatc
tgtaatccgtcggagacaaaaaatcgaatagaaaatttacaaacgatgcaagaagaagac
gtgcaagacgatgacattacgatgcaggatcacgtggaaggcaaagatgacgaaaaattg
actgatagtacgtga

DBGET integrated database retrieval system