KEGG   Burkholderia pseudomallei TSV202: X994_4535Help
Entry
X994_4535         CDS       T03428                                 

Gene name
cga
Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00500  Starch and sucrose metabolism
but01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:but00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    X994_4535 (cga)
Enzymes [BR:but01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     X994_4535 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AIV74485
UniProt: A0A1S0SK46
LinkDB All DBs
Position
2:1003904..1006552
Genome map
AA seq 882 aa AA seqDB search
MSARHFGFKQAVLVGSLAALAGAAALPANTSAAAEAFGSPGAAPVRGPAAKSFLGTAVNG
ASRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAAQTDTRTMS
WQVTTGNSSHNWQIRKIVFADPNHNAIVQRVTFTALNGRKVGDFNLYMLSKPYLDNAGAN
NTAQTVSGSGGTALVANHNSRYSALVASRPWKVVNGVGMTSNGFVGQSDGWTDLLGGTAD
KTMDWTFSSATNGNVAQMGWLDLGDPSATSVSFDVVLGFGGTQDQALGDANTVLGSDLAG
EQQQYDTGWHNYAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDA
NAGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTDCGTAEYNAPGCAQGY
SRVGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGP
WTYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGDTASAARYLAAADYWQENVAAWTY
TSSGAFGNGSYYIRINPAGRAGTGTDRASFAPTAGPDTPQTLSVKNGGGSHDARRVVDGG
FFELVRMGVKRATDPTIANTISVYDSVLGQTLNVANAPALSPNAWFRYNFDGYGEHNDGG
DFDGTGAGRLWPIFTAERGMVEIARQGSGGAGSAYFSTLKQLTTPEGFVPEQVWSNSTTL
PDGWAVTTPAGYTPGQPTKSMAPLNWAMGEYISLLASIQAGRIVDVPSVVCARYNNCAAP
PQSGQVPVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPASYPVWRNTVNLPAAQ
AIQYKYYRKNADGSVTWENRSGNRQLQTPASGTLALNDQVSW
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaggcacttcggattcaagcaggcggtgctggtgggcagtctggccgcgctc
gcgggcgcggcggccctaccggcgaatacttcggccgccgccgaagcattcggctcgccc
ggcgccgcgcccgtgcggggcccggcggccaagtcgttcctcggcacggcggtcaacggc
gcatcgcgggtgtacttcaccggttatcgcggcatcctgtccgaggtctactacccggtc
ctcgatacgcccgagtccgtcgacctgcagttcctcgtcggcgacgccggcaagaccttc
gtcgacgaagaaaagcagcaggcctactcggccgcgcaaacggacacgcgcacgatgagc
tggcaggtgacgaccggcaacagttcgcacaactggcaaattcgcaagatcgtcttcgcc
gatccgaaccacaacgcgatcgtgcagcgcgtcacgttcaccgcgctcaacggccgcaag
gtgggcgacttcaatctctacatgctgtccaagccgtacctcgacaacgccggcgccaac
aataccgcgcaaacggtgtccggcagcggcggcaccgcgctcgtcgcgaatcacaacagc
cgctattcggcgctcgtcgcgagccgcccgtggaaggtggtcaacggcgtgggcatgacg
tcgaacggcttcgtcgggcagagcgacggctggaccgacctgctcggcggcaccgccgac
aagacgatggactggaccttctcgtccgcgaccaacggcaacgtcgcgcagatgggctgg
ctcgacctcggcgatccgagcgcgacgagcgtgtcgttcgacgtcgtgctcggcttcggc
ggcacgcaggaccaggcgctcggcgacgcgaacacggtgctcggcagcgatctcgccggc
gagcagcagcagtacgacaccgggtggcataactacgcggcgggcctgtcgtcgcagaac
ggcgccgcggacgacggctactacctggccgcgatgacgctcaagacgatgcaggacaag
agcaacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgatgcg
aacgcgggcggctatcacctcgtgtggccgcgcgacctgttcaagttcgcgaacgcgctg
acgacggcgggcgacacgtcgagcgcgacgagcgtcgtcaactatctgttcaacacgctg
cagcagacgaccgattgcggcaccgccgaatacaacgcgcccggctgcgcgcagggctac
agccgcgtcgggcgctttccgcagaacgcatgggtgaacggctggccgtactggcagggc
acgcagatggacgagcaggcgatgccgatcatcctcgcgtggcgcctcggcccgagcgtg
ttcaatccgctgtggccgaagatcaagctcaccgccgactacatcgtcaataccggcccc
tggacgtaccaggagcgctgggaggagaacgccggctattcgccgtcgacgatcgccgcc
gagatcgcgggcctcgtcacggcggccgacatcgcgacgcaaaacggcgacacggcgagc
gccgcgcgctacctcgccgcggccgactactggcaggagaacgtcgcggcgtggacgtac
acgtcgagcggcgcgttcggcaacggcagctactacatccggatcaatccggcgggccgc
gcgggcaccggcaccgaccgcgcgagcttcgcgccgaccgccggccccgacacgccgcag
acgctgagcgtgaagaacggcggcggcagccacgacgcgcggcgcgtcgtcgacggcggc
ttcttcgagctcgtccggatgggggtcaagcgcgcgaccgatccgacgatcgccaacacg
atctcggtctacgacagcgtgctcggccagacgctgaacgtcgcgaacgcgccggcgctg
tcgccgaacgcgtggttccgctacaacttcgacggctacggcgaacacaacgacggcggc
gatttcgacggcaccggcgccggccggctgtggccgatcttcaccgccgagcgcggcatg
gtcgagatcgcgcgccagggcagcggcggcgcgggcagcgcgtacttctcgacgctcaag
caattgacgacgcccgagggcttcgtgccggagcaggtgtggtcgaattcgacgacgctg
cccgacggctgggcggtgacgacgcccgcgggctacacgccgggccagccgaccaaatcg
atggcgccgctcaactgggcgatgggcgaatacatcagcctgctcgcgtcgatccaggcg
gggcgcatcgtcgacgtgccgtcggtggtctgcgcgcgctacaacaactgcgccgcgccg
ccgcaaagcgggcaggtgccggtggccgtcaacgtgaacgcgagcacgcagctcggccag
cagatgtacgtgacaggcaacgtcgccgcgctcggcaactggaacaccgatctcggcatt
ccggtcgatccggccagctacccggtgtggcgcaacaccgtcaacctgccggccgctcag
gcgatccagtacaagtactaccggaagaacgcggacggcagcgtgacgtgggagaaccgt
tccggcaaccgccagcttcagacgcccgcgagcggcacgttggcgctgaacgatcaggtg
agctggtga

DBGET integrated database retrieval system