KEGG   Burkholderia vietnamiensis G4: Bcep1808_4686
Entry
Bcep1808_4686     CDS       T00493                                 

Definition
(GenBank) thiamine pyrophosphate enzyme domain protein TPP-binding protein
  KO
K09459  phosphonopyruvate decarboxylase [EC:4.1.1.82]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00440  Phosphonate and phosphinate metabolism
bvi00998  Biosynthesis of various secondary metabolites - part 2
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bcep1808_4686
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    Bcep1808_4686
Enzymes [BR:bvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.82  phosphonopyruvate decarboxylase
     Bcep1808_4686
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N
Other DBs
NCBI-ProteinID: ABO57644
UniProt: A4JMZ1
LinkDB
Position
2:complement(1522190..1523371)
AA seq 393 aa
MIEAAQFVEAARERGFDWYAGVPCSYLTPFINYVLQDPTLHYLSAANEGDAVALIAGATL
GGKRGIAMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQPGVPDEPQHALMGPITPAM
LDTMEIPWETFPTDPEQVGPALDRAVAHMDATGRPYALVMQKGSVASYELKANPAAAPRA
HVAAQSGARAASPAAWPTRHDALQRVIAHTPVDSTVVLASTGFCGRELYAIDDRPNQLYM
VGSMGCVTPLALGLALARPDLRVVAVDGDGAALMRMGVFATLGTYGPSNLTHVLLDNGAH
ESTGGQATVSQHVSFAGVAAACGYASAVEGDTLDVLDATLAAQADGAQFVRVAIRTGVPD
GLPRPTVTPVEVKTRLMRHIGAARTEAHVEGAH
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgatcgaagcggcgcagttcgtcgaggccgcgcgcgagcgcgggttcgactggtacgcg
ggcgtgccgtgctcctacctgacgccgttcatcaactacgtgctgcaggatccgacgctg
cattacctgtcggcggccaacgaaggcgacgcggtcgcactgatcgccggcgcgacgctc
ggcggcaagcgcggcatcgcaatgatgcagaactcgggcctcggcaacgccgtgagcccg
ctcacgtcgttgacgtggacgttccggctgccgcagctgctgatcgtcacgtggcgcggc
cagccgggcgtgcccgacgagccgcagcatgcgctgatggggccgatcacgccggcgatg
ctcgacaccatggagatcccgtgggagacgttcccgaccgaccccgaacaggtcggcccg
gcgctcgaccgcgcggtcgcgcacatggacgcgacgggccgtccgtacgcgctcgtgatg
cagaaaggcagcgtcgcgtcgtatgagttgaaggcgaacccggcggccgcgccgcgcgcg
cacgtcgccgcgcagtcgggcgcgcgcgccgcatcgccggccgcgtggccgacgcgccac
gacgcattgcagcgcgtgatcgcgcatacgccggtcgattcgaccgtcgtgctcgcgtcg
accggcttctgcggccgcgagctgtatgcgatcgacgatcggccgaaccagctgtacatg
gtcggctcgatgggctgcgtgacgccgctcgcgctcggtcttgcgctcgcgcgcccggac
ctgcgcgtggtggccgtcgacggcgacggcgccgcgctgatgcgcatgggcgtgttcgcg
acgctcggcacctatgggccgtcgaacctcacgcacgtgctgctcgacaacggcgcgcac
gaatcgacgggcggtcaggcgaccgtctcgcagcatgtgtcgttcgcgggcgtggctgcc
gcgtgcggttacgcgtcggccgtcgagggcgacacgctcgacgtgctcgatgcgacgctc
gcggcgcaggccgacggcgcacagttcgtacgggtcgcgatccgcaccggtgtgcccgac
gggctgccccgcccgaccgtcacgccagtcgaagtgaagacgcgcctgatgcggcatatc
ggcgccgcacggaccgaagcccacgttgaaggagcccattga

DBGET integrated database retrieval system