KEGG   Bacillus mycoides WSBC 10204: bwei_0703Help
Entry
bwei_0703         CDS       T03453                                 

Definition
(GenBank) yqzE-like family protein
Organism
bww  Bacillus mycoides WSBC 10204
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YqzE
Motif
Other DBs
NCBI-ProteinID: AIW83369
UniProt: A0A084J314
LinkDB All DBs
Position
633952..634152
Genome map
AA seq 66 aa AA seqDB search
MSTNDYVRFVTQQFVSYMDAPKEDRKQQKQQRRAEKEPFLNKWFGVMPLSAALFYRNVKN
KRKKSS
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgtctactaatgattatgtacgctttgtgacacagcaatttgtgtcatatatggatgct
ccaaaagaggatcgaaaacaacagaaacaacaacgtcgtgcggagaaagagccattctta
aataaatggtttggtgttatgccactgagcgctgctttgttttatcgaaatgtaaaaaat
aaaagaaaaaaatcaagctaa

DBGET integrated database retrieval system