KEGG   Castor canadensis (American beaver): 109703285Help
Entry
109703285         CDS       T04791                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04614  Renin-angiotensin system
ccan04924  Renin secretion
ccan05142  Chagas disease (American trypanosomiasis)
ccan05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    109703285
   04614 Renin-angiotensin system
    109703285
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    109703285
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    109703285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccan01002]
    109703285
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccan04147]
    109703285
   04090 CD Molecules [BR:ccan04090]
    109703285
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109703285
Peptidases [BR:ccan01002]
 Metallo Peptidases
  Family M2
   109703285
Exosome [BR:ccan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109703285
CD molecules [BR:ccan04090]
 Proteins
  109703285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 DUF4131 STE3 DUF1138 Mtc Cse1 S1FA
Motif
Other DBs
NCBI-GeneID: 109703285
NCBI-ProteinID: XP_020044006
LinkDB All DBs
Position
Unknown
AA seq 728 aa AA seqDB search
MGTRWTHPGPSLLVLLCYGQLLLLLKTVGDLGLNELYNETEAKLFLQFYEQTAQVVLNQF
METTWNYVTNITKPNQEKMLQKEVERTQFMTYFGTRARLFKITQFQDPAVKRMLSKLQDI
DKAALPKDELQEYNKLLAYMETTYSMGQVCLDEGPCMTLEPDLEEIMATSRDRKELLWAW
QGWRDAVGRQLRPIFGRYVQLSNKAARLNGYKDMGALWRSKYESDTLEQDLEQLYQELQP
LYLNLHAYVRRALYRYYGSEVINTRGPIPAHLLGNMWAQSWVNILDLVLPYPQTPPEDVT
KIMKGQHWKPEKMFAEADMFFTSLGLLAAPPDFWKKSMLERPTDGREVECHASAWDFYKG
NDFRIKKCTEVTIEDLLSIFHQMGHIQYFLQYQNLSILFRTGANPAFEEAVGSMITLSAS
SHKHLLNRGLLSLQHQNSEEEVNFLMGIALEKIALIPFSYLVDLYRWKVFDGTIQKNIYN
QEWWKLRLTYQGLCPPTPRSEEDFDPGSKFHVSASVPYIRYFISLVLQFQFHEALCKASG
HVGPLHRCNIYNSKMAGKILGDVLKVGSSRPWPEVLKELTGKSKVSSEAFMNYFKPLLNW
LVTENVQHGEILGWPDYSCSFEGRGANKVVFLGMEVDLKGFKPALWILLVLGLLLLLIVL
LLACRLYYLEKQSVAVKKVPKTTQATRRQWFLVGLCFIMMPCVISLIIWSLIQHKKSSRL
RDEWWSWD
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaagatggactcaccctggaccttcccttcttgtgcttctctgttatgggcag
ctcttgctattgctcaagactgtgggtgatctgggtttaaatgaattgtacaatgaaact
gaggcaaagctgtttctgcagttttatgagcaaacagcccaggttgtgttgaaccagttc
atggagaccacttggaactatgtcaccaacatcaccaagccaaatcaggagaaaatgctg
cagaaggaggtggagaggacccagttcatgacatactttggcacccgggcccgcctgttt
aagatcacccaattccaggacccggctgtgaagcgcatgctgagtaagctgcaggacata
gacaaggcggccttgcccaaggacgaactccaggagtacaacaagcttctggcctacatg
gagacgacgtacagtatgggccaggtgtgtctggatgaagggccttgcatgaccctggag
cctgaccttgaagagatcatggccacctccagggaccggaaggagctgctgtgggcctgg
cagggctggcgagatgctgtaggtcgccagctgcgccccattttcgggcgctatgtgcag
ctcagcaacaaggctgcgcggctcaatggctacaaagacatgggggctttgtggcgctcc
aagtatgagtctgacaccttggagcaagacttggagcagctctaccaggagctacaacca
ctctacctgaacctgcatgcctatgtgcgccgtgccttgtaccgctactatgggtcagag
gtcatcaacacacggggacccatccctgcccacctcctgggaaacatgtgggctcagtcc
tgggtcaacatcctagacctggtcctgccctatcctcagacgcctccagaggatgtcacg
aagatcatgaaaggccagcactggaagcctgagaaaatgtttgcagaagcagacatgttc
tttacctccttggggctgctagctgccccacctgatttctggaaaaaatctatgctggag
aggccaactgatgggcgggaagtggaatgccatgcctctgcctgggacttctacaagggc
aatgatttcaggataaagaagtgcaccgaggtgaccatagaagacctgctctccatcttc
caccagatgggccatatccagtacttcctgcagtaccagaacctctctatactcttccgc
acaggcgccaacccagcctttgaagaggccgtggggtcgatgatcaccctctcggcctcc
tcccataagcacctgctcaacagaggcctgctcagcctccagcaccagaattcagaggag
gaggtcaacttcctgatgggcattgccctggagaagattgccctcatccccttcagctac
ctggtggacttatatcgctggaaggtcttcgatggcaccatccagaagaacatctacaac
caggagtggtggaagctcaggttgacgtaccagggcctgtgcccccccactccacggtca
gaagaagactttgacccaggttccaagttccatgtttctgccagtgtgccctacatacgg
tacttcatcagcctagtgctccagttccagttccacgaagcgctgtgcaaggcctcaggc
catgtgggccccctgcaccggtgtaacatctataactccaagatggctgggaagatcctg
ggggatgtcctgaaggtaggctccagcaggccctggccagaggtcctaaaggagctgact
gggaagtccaaggtgtcttcagaggccttcatgaactacttcaagccactgttgaactgg
ctggtgactgagaacgtgcagcatggggaaatcctgggctggccagactacagctgttct
tttgaaggaagaggtgcaaacaaagtggtcttcctgggtatggaagtggaccttaagggg
ttcaagcctgcactatggatactgctggtcctgggccttttattgcttctgatagtactg
ttgctagcctgcaggctgtactacctggaaaaacagtcagtggcagtcaaaaaggtgccc
aaaaccacccaggctacccgaagacagtggtttctggtgggtctgtgtttcatcatgatg
ccatgtgtcatcagtctgatcatttggagcctcatacagcacaagaagtcttcacggctc
agagatgaatggtggagctgggactag

DBGET integrated database retrieval system