KEGG   Cyprinus carpio (common carp): 109088214
Entry
109088214         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: NF-kappa-B essential modulator-like
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04210  Apoptosis
ccar04620  Toll-like receptor signaling pathway
ccar04621  NOD-like receptor signaling pathway
ccar04622  RIG-I-like receptor signaling pathway
ccar04623  Cytosolic DNA-sensing pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04920  Adipocytokine signaling pathway
ccar05132  Salmonella infection
ccar05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109088214
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109088214
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109088214
   04621 NOD-like receptor signaling pathway
    109088214
   04622 RIG-I-like receptor signaling pathway
    109088214
   04623 Cytosolic DNA-sensing pathway
    109088214
   04625 C-type lectin receptor signaling pathway
    109088214
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109088214
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109088214
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109088214
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109088214
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109088214
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 DUF1216 DUF1241 COMMD1_N
Other DBs
NCBI-GeneID: 109088214
NCBI-ProteinID: XP_018957935
LinkDB
Position
Unknown
AA seq 560 aa
MASSQGSVGVPPELAGNEVVHRLITDNHQLREALKRSNDALKERCEEMEVWQRRSREERE
FLSCRFREARDLVQRLAEENQSLQGQLNHSISQTGSPSVGISKETGNQGQDQELKCTNVE
KNVLMDSPEVLNEAVLTDRAEGNAGRHTMPQSLPAEGSNDFLKLLKSHKEKLEEGMRALR
RRNEELEKEKTENEKERENLLATVEQLRCKLNQNCGVTEESVQQACALTVPAERYRELQE
KLDCLQKSSVQRDRNEALLKQKEKDFVQLTKDSEALRAQVTSLLGELNERQNWLEKSEAE
RRILEDKFGKKTERLQTLERDMEQQKKQHSVTVDNLLLQTQNLETALKNERLVIVEERRK
LAQLQHAYTCLFQDYDKKLKSEKQANHRSGEADTLANRLAEAEKALALKQDLIDKLKEES
EQLRSALETIPVLNAQAEIYKMDFLAEREARENTNQKKEELQEELSKALVEIDRLKQEGT
SRARIEEMQQRHLEDYRPRPHPPPQAAPFTGAAMFNXAQPPSARRRDEDHDGLPDFCCPK
CMYKAPDMDTLQIHVMDCIQ
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggccagttcacaggggtctgtgggggtccctcctgaattagcgggaaatgaagtggtc
catagactcataacagataatcatcagctacgagaggctctgaagcgaagcaatgatgcc
ctcaaagagagatgcgaagagatggaggtgtggcagaggaggtcaagagaggagcgcgag
ttcctgagctgtaggtttcgtgaggccagagatttagtgcagcgactggcagaggaaaac
cagagcctgcagggacagctcaaccacagcatcagtcaaacagggagtccaagtgtcggc
atctctaaagagaccggaaatcaaggccaggaccaagagctgaagtgcactaatgtagag
aagaatgtcctcatggactcaccggaagtattaaatgaagctgtactgacagaccgagct
gaaggaaacgctggcagacacacaatgcctcaaagtttgcctgctgagggctctaatgat
tttctgaaactgctgaaaagccacaaagagaagctggaggaagggatgagggcactgagg
aggaggaatgaggagctggagaaggagaagacagagaatgagaaagagagagaaaatctc
ctcgccactgtagagcagttacgctgcaaactcaatcagaactgtggtgttactgaagag
tcagtccagcaggcatgcgcgctcaccgttcctgcagaaaggtacagggagctccaggag
aagctggactgtcttcagaagagctctgttcagagagatagaaatgaggctctactcaaa
cagaaggagaaggactttgttcagctgacaaaggatagtgaagctctgagggctcaggtc
acgtcccttctcggtgagttgaatgaacgacagaattggctggagaaaagtgaagcagag
agacggattttagaggacaagtttggcaagaagaccgaacgactgcagactttagagaga
gacatggagcagcagaagaagcagcacagtgtgacagtggacaatcttttactgcagaca
cagaacctagaaactgcactgaagaacgagaggctagtcatagtggaggagaggaggaag
ctggcccagctccaacatgcctacacatgtttgtttcaggattatgacaaaaaactcaaa
agtgagaagcaagccaatcacaggagtggagaggcagatactctagctaacaggttagct
gaggctgagaaagctctggccctgaaacaggacctcatcgataaactcaaggaggaatca
gagcagctgagatctgcattagagactataccagtgctgaacgctcaggcagagatctat
aagatggacttcctagctgagagggaagccagagagaataccaatcaaaagaaggaagag
ttgcaggaggagctgagtaaggcactagttgagatagacagactcaagcaagaaggaacc
tcaagagctcgcattgaagagatgcaacagagacatttggaggactacaggcctcgtcca
caccctcctcctcaagccgcacctttcacaggagcggccatgtttaacnccgcccaacct
ccatctgcacgcagaagagacgaagatcacgacgggctgcctgatttctgctgtcccaaa
tgtatgtacaaggctccagacatggacaccctgcagattcacgtcatggactgtatccag
tga

DBGET integrated database retrieval system