KEGG   Camelus dromedarius (Arabian camel): 105092299
Entry
105092299         CDS       T04642                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04020  Calcium signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04070  Phosphatidylinositol signaling system
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04270  Vascular smooth muscle contraction
cdk04310  Wnt signaling pathway
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04510  Focal adhesion
cdk04540  Gap junction
cdk04613  Neutrophil extracellular trap formation
cdk04650  Natural killer cell mediated cytotoxicity
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04670  Leukocyte transendothelial migration
cdk04713  Circadian entrainment
cdk04720  Long-term potentiation
cdk04723  Retrograde endocannabinoid signaling
cdk04724  Glutamatergic synapse
cdk04725  Cholinergic synapse
cdk04726  Serotonergic synapse
cdk04727  GABAergic synapse
cdk04728  Dopaminergic synapse
cdk04730  Long-term depression
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04911  Insulin secretion
cdk04912  GnRH signaling pathway
cdk04916  Melanogenesis
cdk04918  Thyroid hormone synthesis
cdk04919  Thyroid hormone signaling pathway
cdk04921  Oxytocin signaling pathway
cdk04925  Aldosterone synthesis and secretion
cdk04926  Relaxin signaling pathway
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04929  GnRH secretion
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk04960  Aldosterone-regulated sodium reabsorption
cdk04961  Endocrine and other factor-regulated calcium reabsorption
cdk04970  Salivary secretion
cdk04971  Gastric acid secretion
cdk04972  Pancreatic secretion
cdk05017  Spinocerebellar ataxia
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05031  Amphetamine addiction
cdk05032  Morphine addiction
cdk05143  African trypanosomiasis
cdk05146  Amoebiasis
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05214  Glioma
cdk05223  Non-small cell lung cancer
cdk05225  Hepatocellular carcinoma
cdk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105092299 (PRKCA)
   04012 ErbB signaling pathway
    105092299 (PRKCA)
   04014 Ras signaling pathway
    105092299 (PRKCA)
   04015 Rap1 signaling pathway
    105092299 (PRKCA)
   04310 Wnt signaling pathway
    105092299 (PRKCA)
   04370 VEGF signaling pathway
    105092299 (PRKCA)
   04066 HIF-1 signaling pathway
    105092299 (PRKCA)
   04020 Calcium signaling pathway
    105092299 (PRKCA)
   04070 Phosphatidylinositol signaling system
    105092299 (PRKCA)
   04072 Phospholipase D signaling pathway
    105092299 (PRKCA)
   04071 Sphingolipid signaling pathway
    105092299 (PRKCA)
   04151 PI3K-Akt signaling pathway
    105092299 (PRKCA)
   04150 mTOR signaling pathway
    105092299 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105092299 (PRKCA)
   04540 Gap junction
    105092299 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    105092299 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    105092299 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    105092299 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    105092299 (PRKCA)
   04670 Leukocyte transendothelial migration
    105092299 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    105092299 (PRKCA)
   04929 GnRH secretion
    105092299 (PRKCA)
   04912 GnRH signaling pathway
    105092299 (PRKCA)
   04921 Oxytocin signaling pathway
    105092299 (PRKCA)
   04926 Relaxin signaling pathway
    105092299 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    105092299 (PRKCA)
   04918 Thyroid hormone synthesis
    105092299 (PRKCA)
   04919 Thyroid hormone signaling pathway
    105092299 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    105092299 (PRKCA)
   04916 Melanogenesis
    105092299 (PRKCA)
   04925 Aldosterone synthesis and secretion
    105092299 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105092299 (PRKCA)
   04270 Vascular smooth muscle contraction
    105092299 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    105092299 (PRKCA)
   04971 Gastric acid secretion
    105092299 (PRKCA)
   04972 Pancreatic secretion
    105092299 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105092299 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    105092299 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    105092299 (PRKCA)
   04727 GABAergic synapse
    105092299 (PRKCA)
   04725 Cholinergic synapse
    105092299 (PRKCA)
   04728 Dopaminergic synapse
    105092299 (PRKCA)
   04726 Serotonergic synapse
    105092299 (PRKCA)
   04720 Long-term potentiation
    105092299 (PRKCA)
   04730 Long-term depression
    105092299 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    105092299 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105092299 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    105092299 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105092299 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105092299 (PRKCA)
   05206 MicroRNAs in cancer
    105092299 (PRKCA)
   05205 Proteoglycans in cancer
    105092299 (PRKCA)
   05231 Choline metabolism in cancer
    105092299 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105092299 (PRKCA)
   05214 Glioma
    105092299 (PRKCA)
   05223 Non-small cell lung cancer
    105092299 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    105092299 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    105092299 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    105092299 (PRKCA)
   05032 Morphine addiction
    105092299 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105092299 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105092299 (PRKCA)
   05161 Hepatitis B
    105092299 (PRKCA)
   05171 Coronavirus disease - COVID-19
    105092299 (PRKCA)
   05164 Influenza A
    105092299 (PRKCA)
   05163 Human cytomegalovirus infection
    105092299 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105092299 (PRKCA)
   05143 African trypanosomiasis
    105092299 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105092299 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105092299 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105092299 (PRKCA)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     105092299 (PRKCA)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   105092299 (PRKCA)
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    105092299 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 105092299
NCBI-ProteinID: XP_031324778
LinkDB
Position
16
AA seq 688 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAVVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRRPPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVTFCTKMHWLQWASRPSCGKGAENFDKFFTRGQPVLTPPDQLV
IANIDQSDFEGFSYVNPQFVHPILQSAV
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgagacagaagaacgtgcacgaggtgaagaaccacaaattcatc
gcccgcttctttaagcagcccaccttctgcagccactgtaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgag
ttcgttactttttcttgtccgggtgcggataaaggacctgacactgatgaccccaggagc
aagcacaagtttaagatccacacttacggaagccccaccttctgtgatcactgcgggtca
ctgctgtatggacttatccatcaggggatgaaatgcgacacctgtgatatgaatgtgcac
aagcagtgtgtcatcaacgtgcccagcctctgcgggatggaccacaccgagaagaggggg
cggatctacctgaaggccgtggtcgccgacgagaagctccacgtcacggtacgagacgca
aaaaatctaatccctatggatccaaatgggctttcagatccttatgtgaagctgaaactt
attcctgatcctaagaatgaaagcaaacaaaaaaccaaaaccatccgctcgacgctaaac
ccccagtggaatgaatcctttacattcaaattaaaaccttcagataaagaccgacgactg
tccgtagaaatctgggactgggatcgaacaacaaggaacgacttcatggggtccctctcc
ttcggagtttcagagctgatgaagatgccagccagtggatggtacaagctgcttaaccag
gaggaaggggagtactacaacgtgcccattccagaaggggacgaagaaggaaacgtggag
ctcaggcagaaattcgagaaagccaagcttggccctgctggtaacaaagtcatcagtcct
tctgaagacaggcgaccgccttccaacaaccttgacagagtgaaactcacagacttcaat
ttcctcatggtgctggggaagggcagttttgggaaggtgatgctggcggacaggaagggg
acagaagaactgtacgccatcaaaatcctgaagaaggacgtggtgattcaggatgacgac
gtggagtgcaccatggtggagaagcgagttctggccctgctcgacaagcccccattcctg
acgcagttacactcctgcttccagacagtggaccggctgtacttcgtcatggagtatgtc
aatggcggggacctcatgtaccacatccagcaagtgggaaagtttaaggaaccacaagca
gtattctacgcagcagagatttccatcgggctgttctttcttcacaagagaggaatcatt
tacagggacctgaagttagataacgtcatgctggactcggaaggacacatcaagattgct
gattttgggatgtgcaaggaacacatgatggatggggtcacgaccaggaccttctgtggg
actccagattatatcgccccagagataattgcttatcagccatatgggaaatccgtggac
tggtgggcctatggtgtcctgttatatgaaatgctggccgggcagcccccatttgatggt
gaagacgaggatgagctgtttcagtccatcatggagcacaacgtttcgtatccaaagtcc
ttgtccaaggaggccgtctccatctgcaaaggcctgatgaccaaacaccccggcaagcgg
ctgggctgtgggccggagggagagagagacgtccgggaacacgccttcttccggaggatc
gactgggagaagctagagaacagggagatccagccgccatttaagcccaaagtgactttc
tgtaccaaaatgcactggcttcagtgggcatccaggccttcgtgcggcaaaggagcagaa
aactttgacaagttcttcacgcgagggcagcctgtcttaacaccacctgatcagctggtt
atcgctaacatagaccagtctgatttcgaagggttctcgtatgtcaacccccagtttgtg
caccccatcctccagagcgcggtatga

KEGG   Camelus dromedarius (Arabian camel): 105094833
Entry
105094833         CDS       T04642                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04020  Calcium signaling pathway
cdk04062  Chemokine signaling pathway
cdk04064  NF-kappa B signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04070  Phosphatidylinositol signaling system
cdk04071  Sphingolipid signaling pathway
cdk04150  mTOR signaling pathway
cdk04270  Vascular smooth muscle contraction
cdk04310  Wnt signaling pathway
cdk04370  VEGF signaling pathway
cdk04510  Focal adhesion
cdk04540  Gap junction
cdk04613  Neutrophil extracellular trap formation
cdk04650  Natural killer cell mediated cytotoxicity
cdk04662  B cell receptor signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04670  Leukocyte transendothelial migration
cdk04713  Circadian entrainment
cdk04720  Long-term potentiation
cdk04723  Retrograde endocannabinoid signaling
cdk04724  Glutamatergic synapse
cdk04725  Cholinergic synapse
cdk04726  Serotonergic synapse
cdk04727  GABAergic synapse
cdk04728  Dopaminergic synapse
cdk04730  Long-term depression
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04911  Insulin secretion
cdk04912  GnRH signaling pathway
cdk04916  Melanogenesis
cdk04918  Thyroid hormone synthesis
cdk04919  Thyroid hormone signaling pathway
cdk04921  Oxytocin signaling pathway
cdk04925  Aldosterone synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04929  GnRH secretion
cdk04931  Insulin resistance
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk04960  Aldosterone-regulated sodium reabsorption
cdk04961  Endocrine and other factor-regulated calcium reabsorption
cdk04970  Salivary secretion
cdk04971  Gastric acid secretion
cdk04972  Pancreatic secretion
cdk04973  Carbohydrate digestion and absorption
cdk05017  Spinocerebellar ataxia
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05031  Amphetamine addiction
cdk05032  Morphine addiction
cdk05140  Leishmaniasis
cdk05143  African trypanosomiasis
cdk05146  Amoebiasis
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05214  Glioma
cdk05223  Non-small cell lung cancer
cdk05225  Hepatocellular carcinoma
cdk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105094833 (PRKCB)
   04012 ErbB signaling pathway
    105094833 (PRKCB)
   04014 Ras signaling pathway
    105094833 (PRKCB)
   04015 Rap1 signaling pathway
    105094833 (PRKCB)
   04310 Wnt signaling pathway
    105094833 (PRKCB)
   04370 VEGF signaling pathway
    105094833 (PRKCB)
   04064 NF-kappa B signaling pathway
    105094833 (PRKCB)
   04066 HIF-1 signaling pathway
    105094833 (PRKCB)
   04020 Calcium signaling pathway
    105094833 (PRKCB)
   04070 Phosphatidylinositol signaling system
    105094833 (PRKCB)
   04071 Sphingolipid signaling pathway
    105094833 (PRKCB)
   04150 mTOR signaling pathway
    105094833 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105094833 (PRKCB)
   04540 Gap junction
    105094833 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    105094833 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    105094833 (PRKCB)
   04662 B cell receptor signaling pathway
    105094833 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    105094833 (PRKCB)
   04670 Leukocyte transendothelial migration
    105094833 (PRKCB)
   04062 Chemokine signaling pathway
    105094833 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    105094833 (PRKCB)
   04929 GnRH secretion
    105094833 (PRKCB)
   04912 GnRH signaling pathway
    105094833 (PRKCB)
   04921 Oxytocin signaling pathway
    105094833 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    105094833 (PRKCB)
   04918 Thyroid hormone synthesis
    105094833 (PRKCB)
   04919 Thyroid hormone signaling pathway
    105094833 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    105094833 (PRKCB)
   04916 Melanogenesis
    105094833 (PRKCB)
   04925 Aldosterone synthesis and secretion
    105094833 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105094833 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    105094833 (PRKCB)
   04971 Gastric acid secretion
    105094833 (PRKCB)
   04972 Pancreatic secretion
    105094833 (PRKCB)
   04973 Carbohydrate digestion and absorption
    105094833 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105094833 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    105094833 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    105094833 (PRKCB)
   04727 GABAergic synapse
    105094833 (PRKCB)
   04725 Cholinergic synapse
    105094833 (PRKCB)
   04728 Dopaminergic synapse
    105094833 (PRKCB)
   04726 Serotonergic synapse
    105094833 (PRKCB)
   04720 Long-term potentiation
    105094833 (PRKCB)
   04730 Long-term depression
    105094833 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    105094833 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105094833 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105094833 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105094833 (PRKCB)
   05206 MicroRNAs in cancer
    105094833 (PRKCB)
   05205 Proteoglycans in cancer
    105094833 (PRKCB)
   05231 Choline metabolism in cancer
    105094833 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105094833 (PRKCB)
   05214 Glioma
    105094833 (PRKCB)
   05223 Non-small cell lung cancer
    105094833 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    105094833 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    105094833 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    105094833 (PRKCB)
   05032 Morphine addiction
    105094833 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105094833 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105094833 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105094833 (PRKCB)
   05161 Hepatitis B
    105094833 (PRKCB)
   05171 Coronavirus disease - COVID-19
    105094833 (PRKCB)
   05164 Influenza A
    105094833 (PRKCB)
   05163 Human cytomegalovirus infection
    105094833 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105094833 (PRKCB)
   05140 Leishmaniasis
    105094833 (PRKCB)
   05143 African trypanosomiasis
    105094833 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105094833 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105094833 (PRKCB)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     105094833 (PRKCB)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   105094833 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 105094833
NCBI-ProteinID: XP_031288895
LinkDB
Position
18
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGGEGNEE
LRQKFERAKIGQGTKAPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALAGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDVKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagtgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
ggaaagcaaggattccagtgccaagtctgctgttttgtcgtgcacaagcggtgccatgaa
tttgtcactttctcctgcccaggcgctgacaagggcccagcctccgacgacccccggagc
aaacacaagttcaagatccacacatactccagccccacgttttgtgaccactgtgggtca
ctgctgtatggactcatccaccaggggatgaagtgtgacacctgcatgatgaacgtgcac
aagcgctgcgtgatgaacgtccccagcctctgcggcacggaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgagagggaggtcctcatcgtcgtcgtaagagatgct
aaaaaccttgtacctatggaccccaacggcttgtcagatccttatgtgaaactgaaactg
attcctgatcccaagagtgagagcaagcaaaagaccaaaaccattaagtgctccctcaac
cccgagtggaacgagacatttagattccagctgaaggagtcggacaaggacagaagactg
tccgtagagatttgggactgggatctgaccagcaggaatgacttcatgggatctttgtca
tttgggatttctgaactgcagaaagctggcgttgatggttggtttaagttgctgagccag
gaggaaggcgagtacttcaacgtacctgtgcccccagaaggaggggagggcaatgaagaa
ctgcggcagaaatttgagagggccaagatcgggcaggggaccaaggctcccgaagaaaag
acgaccaacactgtatccaaatttgacaacaacgggaacagggaccggatgaaactgacc
gattttaacttcctgatggtgctggggaaaggcagctttggcaaggtcatgctctcagag
cggaagggcaccgatgagctgtacgccgtgaagatcctgaagaaggacgtggtcatccag
gacgacgacgtggagtgcacgatggtggagaagcgggtgctggccctggctgggaagccg
ccgttcctgacgcagctccactcctgcttccagaccatggaccgcctgtactttgtgatg
gagtacgtgaacggtggcgacctcatgtaccacatccagcaagtaggccggttcaaggaa
cctcacgccgtattttacgctgcggaaattgccatcggtctgttcttcttacagagcaag
ggcatcatttaccgtgacctgaaacttgacaacgtgatgctggactccgagggacacatc
aagatcgctgacttcggcatgtgtaaggagaacatctgggacggcgtgacgaccaagacc
ttctgcggcactccagactacatcgcccccgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggagtcctgctgtatgaaatgttagctgggcaggcaccc
tttgaaggggaggatgaggatgaactcttccagtccatcatggaacacaatgtggcttat
ccaaagtccatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacaccca
ggcaaacgtctgggctgtggacctgaaggtgaacgcgacgtcaaagagcatgcgtttttc
cgatacattgactgggagaaacttgaacgcaaagagatccagcccccgtataagccaaaa
gcttgtgggcgaaatgctgaaaacttcgaccgatttttcacccgccatccacccgtccta
acacctcctgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

KEGG   Camelus dromedarius (Arabian camel): 105103265
Entry
105103265         CDS       T04642                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04020  Calcium signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04070  Phosphatidylinositol signaling system
cdk04071  Sphingolipid signaling pathway
cdk04150  mTOR signaling pathway
cdk04270  Vascular smooth muscle contraction
cdk04310  Wnt signaling pathway
cdk04370  VEGF signaling pathway
cdk04510  Focal adhesion
cdk04540  Gap junction
cdk04613  Neutrophil extracellular trap formation
cdk04650  Natural killer cell mediated cytotoxicity
cdk04666  Fc gamma R-mediated phagocytosis
cdk04670  Leukocyte transendothelial migration
cdk04713  Circadian entrainment
cdk04720  Long-term potentiation
cdk04723  Retrograde endocannabinoid signaling
cdk04724  Glutamatergic synapse
cdk04725  Cholinergic synapse
cdk04726  Serotonergic synapse
cdk04727  GABAergic synapse
cdk04728  Dopaminergic synapse
cdk04730  Long-term depression
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04911  Insulin secretion
cdk04916  Melanogenesis
cdk04918  Thyroid hormone synthesis
cdk04919  Thyroid hormone signaling pathway
cdk04921  Oxytocin signaling pathway
cdk04925  Aldosterone synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04929  GnRH secretion
cdk04935  Growth hormone synthesis, secretion and action
cdk04960  Aldosterone-regulated sodium reabsorption
cdk04961  Endocrine and other factor-regulated calcium reabsorption
cdk04970  Salivary secretion
cdk04971  Gastric acid secretion
cdk04972  Pancreatic secretion
cdk05017  Spinocerebellar ataxia
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05031  Amphetamine addiction
cdk05032  Morphine addiction
cdk05143  African trypanosomiasis
cdk05146  Amoebiasis
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05214  Glioma
cdk05223  Non-small cell lung cancer
cdk05225  Hepatocellular carcinoma
cdk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105103265 (PRKCG)
   04012 ErbB signaling pathway
    105103265 (PRKCG)
   04014 Ras signaling pathway
    105103265 (PRKCG)
   04015 Rap1 signaling pathway
    105103265 (PRKCG)
   04310 Wnt signaling pathway
    105103265 (PRKCG)
   04370 VEGF signaling pathway
    105103265 (PRKCG)
   04066 HIF-1 signaling pathway
    105103265 (PRKCG)
   04020 Calcium signaling pathway
    105103265 (PRKCG)
   04070 Phosphatidylinositol signaling system
    105103265 (PRKCG)
   04071 Sphingolipid signaling pathway
    105103265 (PRKCG)
   04150 mTOR signaling pathway
    105103265 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105103265 (PRKCG)
   04540 Gap junction
    105103265 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    105103265 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    105103265 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    105103265 (PRKCG)
   04670 Leukocyte transendothelial migration
    105103265 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    105103265 (PRKCG)
   04929 GnRH secretion
    105103265 (PRKCG)
   04921 Oxytocin signaling pathway
    105103265 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    105103265 (PRKCG)
   04918 Thyroid hormone synthesis
    105103265 (PRKCG)
   04919 Thyroid hormone signaling pathway
    105103265 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    105103265 (PRKCG)
   04916 Melanogenesis
    105103265 (PRKCG)
   04925 Aldosterone synthesis and secretion
    105103265 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105103265 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    105103265 (PRKCG)
   04971 Gastric acid secretion
    105103265 (PRKCG)
   04972 Pancreatic secretion
    105103265 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105103265 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    105103265 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    105103265 (PRKCG)
   04727 GABAergic synapse
    105103265 (PRKCG)
   04725 Cholinergic synapse
    105103265 (PRKCG)
   04728 Dopaminergic synapse
    105103265 (PRKCG)
   04726 Serotonergic synapse
    105103265 (PRKCG)
   04720 Long-term potentiation
    105103265 (PRKCG)
   04730 Long-term depression
    105103265 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    105103265 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105103265 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105103265 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105103265 (PRKCG)
   05206 MicroRNAs in cancer
    105103265 (PRKCG)
   05205 Proteoglycans in cancer
    105103265 (PRKCG)
   05231 Choline metabolism in cancer
    105103265 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105103265 (PRKCG)
   05214 Glioma
    105103265 (PRKCG)
   05223 Non-small cell lung cancer
    105103265 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    105103265 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    105103265 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    105103265 (PRKCG)
   05032 Morphine addiction
    105103265 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105103265 (PRKCG)
   05161 Hepatitis B
    105103265 (PRKCG)
   05171 Coronavirus disease - COVID-19
    105103265 (PRKCG)
   05163 Human cytomegalovirus infection
    105103265 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105103265 (PRKCG)
   05143 African trypanosomiasis
    105103265 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105103265 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105103265 (PRKCG)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     105103265 (PRKCG)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   105103265 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 105103265
NCBI-ProteinID: XP_010995137
UniProt: A0A5N4DUH2
LinkDB
Position
9
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPTIRAHGFFRWIDWDRLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPISPAPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctttgaggcagaaggtggtccacgaagtcaagagtcacaagtttaccgct
cgcttcttcaagcagccaaccttctgcagccactgcactgacttcatatgggggattgga
aaacagggcctacaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaaaggcccccagacagacgatccccggaacaag
cacaagttccgtctgcacagctacagcagccccaccttctgcgaccactgcggctccctc
ctctacgggctggtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgcagcgtcccctctctgtgcggtgtggatcacaccgagcgccgcggccgc
ctgcagctggagatccgggctccgacctcggatgagattcacgtcacggttggcgaggcc
cgtaacctcatcccaatggaccccaatggtctgtctgatccctatgtgaaactgaagctc
atcccagaccctcggaatttgacaaaacaaaagacccggacggtgaaagccacgctaaac
cctgtgtggaacgagacctttgtcttcaacctgaagccgggggacgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacttcgcgcaacgactttatgggtgccatgtcc
tttggcgtctcggagctgctcaaagcgccagtggacggctggtacaagttactgaaccag
gaggagggcgaatattacaatgtgccggtggctgatgctgacaactgcagcctcctccag
aagtttgaggcctgtaactaccccctggaactgtatgagagggtgcggatgggtccctct
tcctctcccatcccctccccatcccccagccccaccgactccaagcgctgtttcttcggg
gcgagccctggacgtctgcacatctccgacttcagcttcctcatggttctgggaaaaggc
agctttgggaaggtgatgctggcagagcgcaggggctccgatgagctctatgccatcaag
atcctgaagaaagacgtgattgtccaggatgatgacgtggactgcaccctggtggagaaa
cgcgtgctggccctggggggccgaggccccggaggccggcctcactttctcacccagctt
cactccaccttccagaccccggaccgcctgtattttgtgatggagtatgtcaccgggggc
gacttgatgtaccacattcagcagttgggcaagtttaaggagccccatgcagcgttctac
gcagcagaaatcgccatcggcctcttcttccttcacaatcagggcatcatctaccgggac
ctgaaactggacaacgtgatgctggatgctgaaggacacatcaaaatcactgactttggc
atgtgtaaggagaacgtcttccccgggaccacaactcgcacattctgtgggaccccagac
tacatagcccccgagatcattgcctaccagccctatgggaagtctgttgactggtggtcc
tttggggttctgctgtatgagatgttggcaggacagcccccctttgatggggaggacgag
gaggagttgttccaggccatcatggaacaaactgtcacctaccccaagtcactttcccgg
gaagctgtggccatctgcaaggggttcctaaccaagcacccagcaaagcgcctgggctca
gggccagacggagaacccaccatccgagctcatggctttttccgctggatcgactgggac
cggctggaacgactggagatcgcgcctccgttcagaccccgcccgtgtggccgcagcggc
gagaacttcgacaagttcttcacgcgagcagcgccagcgttgacaccgccagaccgccta
gttctggccagcatcgaccaagccgatttccaaggcttcacctatgtcaacccggatttc
gtgcacccagatgcccgcagccccatcagcccagcgcctgtgccagtcatgtaa

DBGET integrated database retrieval system