KEGG   Camelus dromedarius (Arabian camel): 105102595
Entry
105102595         CDS       T04642                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01523  Antifolate resistance
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04064  NF-kappa B signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04071  Sphingolipid signaling pathway
cdk04137  Mitophagy - animal
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04211  Longevity regulating pathway
cdk04218  Cellular senescence
cdk04380  Osteoclast differentiation
cdk04620  Toll-like receptor signaling pathway
cdk04621  NOD-like receptor signaling pathway
cdk04622  RIG-I-like receptor signaling pathway
cdk04623  Cytosolic DNA-sensing pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04657  IL-17 signaling pathway
cdk04658  Th1 and Th2 cell differentiation
cdk04659  Th17 cell differentiation
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04668  TNF signaling pathway
cdk04722  Neurotrophin signaling pathway
cdk04917  Prolactin signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk04926  Relaxin signaling pathway
cdk04931  Insulin resistance
cdk04932  Non-alcoholic fatty liver disease
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05030  Cocaine addiction
cdk05132  Salmonella infection
cdk05133  Pertussis
cdk05134  Legionellosis
cdk05135  Yersinia infection
cdk05140  Leishmaniasis
cdk05142  Chagas disease
cdk05145  Toxoplasmosis
cdk05146  Amoebiasis
cdk05152  Tuberculosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05203  Viral carcinogenesis
cdk05212  Pancreatic cancer
cdk05215  Prostate cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05321  Inflammatory bowel disease
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105102595 (RELA)
   04014 Ras signaling pathway
    105102595 (RELA)
   04064 NF-kappa B signaling pathway
    105102595 (RELA)
   04668 TNF signaling pathway
    105102595 (RELA)
   04066 HIF-1 signaling pathway
    105102595 (RELA)
   04071 Sphingolipid signaling pathway
    105102595 (RELA)
   04024 cAMP signaling pathway
    105102595 (RELA)
   04151 PI3K-Akt signaling pathway
    105102595 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    105102595 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    105102595 (RELA)
   04218 Cellular senescence
    105102595 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105102595 (RELA)
   04621 NOD-like receptor signaling pathway
    105102595 (RELA)
   04622 RIG-I-like receptor signaling pathway
    105102595 (RELA)
   04623 Cytosolic DNA-sensing pathway
    105102595 (RELA)
   04625 C-type lectin receptor signaling pathway
    105102595 (RELA)
   04660 T cell receptor signaling pathway
    105102595 (RELA)
   04658 Th1 and Th2 cell differentiation
    105102595 (RELA)
   04659 Th17 cell differentiation
    105102595 (RELA)
   04657 IL-17 signaling pathway
    105102595 (RELA)
   04662 B cell receptor signaling pathway
    105102595 (RELA)
   04062 Chemokine signaling pathway
    105102595 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105102595 (RELA)
   04917 Prolactin signaling pathway
    105102595 (RELA)
   04926 Relaxin signaling pathway
    105102595 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105102595 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    105102595 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    105102595 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105102595 (RELA)
   05202 Transcriptional misregulation in cancer
    105102595 (RELA)
   05203 Viral carcinogenesis
    105102595 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105102595 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105102595 (RELA)
   05221 Acute myeloid leukemia
    105102595 (RELA)
   05220 Chronic myeloid leukemia
    105102595 (RELA)
   05215 Prostate cancer
    105102595 (RELA)
   05222 Small cell lung cancer
    105102595 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    105102595 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105102595 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    105102595 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    105102595 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105102595 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    105102595 (RELA)
   04931 Insulin resistance
    105102595 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105102595 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105102595 (RELA)
   05135 Yersinia infection
    105102595 (RELA)
   05133 Pertussis
    105102595 (RELA)
   05134 Legionellosis
    105102595 (RELA)
   05152 Tuberculosis
    105102595 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105102595 (RELA)
   05170 Human immunodeficiency virus 1 infection
    105102595 (RELA)
   05162 Measles
    105102595 (RELA)
   05164 Influenza A
    105102595 (RELA)
   05161 Hepatitis B
    105102595 (RELA)
   05160 Hepatitis C
    105102595 (RELA)
   05168 Herpes simplex virus 1 infection
    105102595 (RELA)
   05163 Human cytomegalovirus infection
    105102595 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105102595 (RELA)
   05169 Epstein-Barr virus infection
    105102595 (RELA)
   05165 Human papillomavirus infection
    105102595 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105102595 (RELA)
   05145 Toxoplasmosis
    105102595 (RELA)
   05140 Leishmaniasis
    105102595 (RELA)
   05142 Chagas disease
    105102595 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    105102595 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105102595 (RELA)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    105102595 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Cuticle_3
Other DBs
NCBI-GeneID: 105102595
NCBI-ProteinID: XP_031303872
LinkDB
Position
Unknown
AA seq 553 aa
MDDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLHLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPSRSSASIPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGQIPSQTSALAPAPAPVLAQTPAPAPAPAMASALAQAPAPVPVLAPGLAQ
AVAPPAPKTNQAGEGTLTEALLQLQFDADEDLGALLGNNNDTAVFTDLASVDNSEFQQLL
NQGVPIAPHAAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLSGDEDFSSIA
DMDFSALLSQIGS
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggacgacctcttccctctcatcttcccggcggagccagcccaggcctctggtccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgctttcgctacaagtgcgagggc
cgctcagcaggcagtatcccaggagagaggagcacggataccaccaagacccaccccacc
atcaagatcaatggctacacggggccagggacagttcgcatctccctggtcaccaaggac
ccccctcaccggccccacccccatgagctcgtggggaaagactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagcttccagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagtcagcgcatccagaccaacaataacccc
ttccaagttcctatagaagagcagcgcggggactacgacctgaatgctgtgcgcctctgc
ttccaggtgacagtgcgggacccagcagggaggcccctccacctgtcacctgtcctctct
catcctatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaat
cgaaactctgggagctgccttgggggggatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttca
caagctgatgtgcaccgacaagtggccattgttttccggacacccccctacgcagacccc
agcctgcaggcccctgtgcgcgtctccatgcagctgcggcggccttccgatcgggagctc
agcgagcccatggaattccagtacttgccagacacagatgaccgtcaccggattgaggag
aaacgcaaaagaacatacgagacttttaagagcatcatgaaaaagagccctttcaatggc
cccaccgacccccggcctccaacccggcgcattgctgtgccttcccgcagctcagcttcc
atccccaagccagctccccagccctatccatttacgccatctctcagcaccatcaatttt
gaggagttttcccccatggtctttccttctgggcagatcccaagccagacctcggccttg
gcaccagcccctgccccagtcctggcccagaccccagcccctgcccctgccccagccatg
gcatcagccctggcccaggccccagcccctgtcccagtcctagccccaggcctggctcag
gctgtggccccgcctgcccccaagaccaaccaggctggggaagggacactgacagaggcc
ctgctgcagctgcagtttgatgctgatgaagacctgggggccctgcttggcaataacaac
gacacagccgtgttcacagacctggcatctgtcgacaactctgagtttcagcagctgctg
aaccagggtgtacccatagccccccacgcagctgagcccatgctgatggagtaccctgag
gctataactcgcctggtgaccgggtcccagaggccccctgacccagctcccacccccctg
ggcgcctctgggctcaccaacggcctcctctcgggggatgaagacttctcttccattgcg
gacatggacttctcagcccttctgagtcagatcggctcctaa

DBGET integrated database retrieval system