KEGG   Candida dubliniensis: CD36_29870Help
Entry
CD36_29870        CDS       T01140                                 

Definition
(RefSeq) hexokinase-2, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cdu  Candida dubliniensis
Pathway
cdu00010  Glycolysis / Gluconeogenesis
cdu00051  Fructose and mannose metabolism
cdu00052  Galactose metabolism
cdu00500  Starch and sucrose metabolism
cdu00520  Amino sugar and nucleotide sugar metabolism
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
cdu01200  Carbon metabolism
Module
cdu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cdu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD36_29870
   00051 Fructose and mannose metabolism
    CD36_29870
   00052 Galactose metabolism
    CD36_29870
   00500 Starch and sucrose metabolism
    CD36_29870
   00520 Amino sugar and nucleotide sugar metabolism
    CD36_29870
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CD36_29870
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CD36_29870
Membrane trafficking [BR:cdu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CD36_29870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 8050127
NCBI-ProteinID: XP_002422011
UniProt: B9WLQ0
LinkDB All DBs
Position
R:984790..986244
Genome map
AA seq 484 aa AA seqDB search
MVHLGPKPAQKRKGTFTDVSPQLLDALKPIQEQFTISADTLRAIVKHFISELDRGLSKAG
GNIPMIPGWVMDFPTGKETGSYIAIDLGGTNLRVVLVKLGGNRDFDTTQSKFALPPHMRT
ATSDELWDFIAKCLKDFVDEIYPDGCTEPLPLGFTFSYPASQSRINEGILQRWTKGWAID
GIEGKDVVPMLQKAIKKVGVPINVVALINDTTGTLVASMYTDPEAKMGLIFGTGVNGAYF
DVVKDIPKLEGKCPADIPPESPMAINCEYGSFDNEKYILPRTKYDVQIDEESPRPGQQTF
EKMISGYYLGEVLRLILLEFAEEKKLIFKGQNIDKLKIPYVMDASYPSRIEEDPFENLSD
VADLFREKLGIETTEPERKIIRRLAELIGERSARFSVCGIAAICQKRGYETAHCAADGSV
YNKYPGFKERTAQALRDIYEWPADIKDPIIIVPAEDGSGVGAAIIAALTEKRLREGKSVG
LLEA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatctcggtccaaaacctgctcagaaaagaaagggaactttcactgatgtttct
cctcaattattagacgctcttaaaccaattcaagagcaatttactatttctgcagacaca
ttaagagccattgtcaaacatttcatctcagaattagaccgtggtttatcaaaagctggt
ggtaacattcctatgattcctggttgggtcatggatttcccaactggtaaggaaactggt
tcttatattgccattgacttgggtggaaccaacttgagagttgtcttggtaaaattaggc
ggtaatagagattttgacactactcaatccaaatttgctttgccacctcacatgagaact
gccaccctggacgaattgtgggattttattgctaaatgtttgaaagattttgttgatgaa
atctacccagacggctgcactgaaccattgccattgggtttcacattcagttacccagct
tcccaaagccgtatcaatgaaggtattttgcaaagatggactaaaggttgggccattgat
ggaattgaaggaaaagatgttgtcccaatgttgcaaaaagccattaagaaagttggcgtg
ccaattaatgttgttgcattgattaacgataccactggtacattagtcgcttccatgtat
actgacccagaagctaagatgggtttgattttcggtactggtgtcaatggtgcttatttc
gatgttgtcaaggatattcctaaattggaaggtaaatgtccagcagatattccaccagaa
tcaccaatggccatcaactgtgaatacggttcatttgataatgaaaagtatatcttacca
agaactaaatatgatgttcaaattgacgaggagtcaccaagaccaggtcaacaaactttc
gaaaagatgatctctggttactatttgggagaagttttgagattgattttattagaattt
gctgaagagaagaaattgatctttaaaggtcaaaacattgacaaattgaagatcccatat
gttatggatgcttcctacccatcaagaatcgaagaagatccatttgaaaacttgtctgat
gtcgcagacttgtttagagaaaaattaggtattgaaaccacagaaccagaaagaaagatc
attcgtcgtttggctgaattgattggtgaaagatctgctagattctctgtttgtggtatt
gctgccatttgtcaaaagagaggttatgaaactgctcattgtgctgctgacggttcagtg
tacaacaagtacccaggattcaaagaaagaactgctcaagctttaagagacatctatgaa
tggccagcagatattaaggatccaatcatcattgttccagccgaagatggtagtggtgtt
ggtgctgctattattgctgctttgacagaaaagagattgagagaaggaaaatccgttggt
ttgttagaggcttag

DBGET integrated database retrieval system