KEGG   Clostridium diolis: F3K33_23265
Entry
F3K33_23265       CDS       T06237                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cdy  Clostridium diolis
Pathway
cdy00520  Amino sugar and nucleotide sugar metabolism
cdy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    F3K33_23265 (nagA)
Enzymes [BR:cdy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     F3K33_23265 (nagA)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-ProteinID: QES75568
UniProt: A0A5P2F238
LinkDB
Position
5202467..5203603
AA seq 378 aa
MLIRNCNIIYLDKIEQGSILVEDGKIKEINPSNIDTDSILDANGLYVSPGFIDVHIHGAG
GSDTMDGTSESINTISKTIIKHGTTSFTPTTMTVAVNDIRKSLDSIKRVKEKGSDGAHIL
GVHLEGPFVSPKAIGAQNPNYILMPSISTYNDIVKDYEDIIISITLAPEVEGAKELIKYL
SSIGIVCSLGHSSATYEETMEAIECGACHATHLFNAMTPLTHRNPGVVGAVFDSDITTET
ISDGIHISYPALRIAYKQKGTDNVLLISDAMMACCMPNGNYSLGGQDVIVNDGEARLKNG
ALAGSVLTLDKAVKNVYKNSNLPLYEVIKMASYNGAKHCKVEDHKGQIKEGYDADLILFD
DDINIKKVLVLGKEVYSE
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgttaataagaaattgtaatataatttacctagacaagatagaacaaggttcaattcta
gttgaggatgggaaaattaaagagataaatccgtccaatatagatacagacagcatttta
gatgcaaatggtctatatgtttcacctggttttattgatgttcatatacacggcgcagga
ggctcagatacaatggacggtaccagtgaatcaattaataccatttctaaaactataatt
aaacacggaacaacttcattcactcctacaactatgactgttgctgtgaacgatataaga
aaatctttagactcaattaaaagggtaaaagaaaaaggttcagacggtgcacatattctt
ggagtacacttagaaggtccgtttgtaagtccgaaagcaattggtgctcaaaatcccaac
tatattttgatgccatctatttcaacttacaatgatatagttaaggattatgaggatatt
atcatatctataacattagctccagaagttgaaggtgctaaagaacttattaagtattta
tcctcaattggaatagtctgctcattagggcatagtagtgctacttatgaagagactatg
gaagctattgaatgtggtgcttgccatgcaactcatctttttaatgctatgactccttta
actcacagaaatccaggagtagtaggagctgtatttgacagtgatataacaactgaaact
atttcagatggaattcatatttcatatccagctttaagaattgcttacaaacaaaaaggt
actgataatgttttattaatatctgatgctatgatggcttgctgcatgcctaatggtaac
tactccttaggagggcaagatgttattgttaatgatggtgaagcacgtttaaaaaatggt
gctttagctggttctgttcttacccttgataaagcagtaaaaaatgtatacaaaaactct
aatttaccactttatgaagtaataaaaatggcatcttataatggcgctaaacattgtaaa
gttgaggatcataaagggcagatcaaggaaggctatgatgcagacttgatattgtttgat
gatgatataaatataaaaaaggtattagttttaggtaaggaagtatactcagaataa

DBGET integrated database retrieval system