KEGG   Canis familiaris (dog): 403580Help
Entry
403580            CDS       T01007                                 

Gene name
ACTB
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04015  Rap1 signaling pathway
cfa04145  Phagosome
cfa04210  Apoptosis
cfa04390  Hippo signaling pathway
cfa04510  Focal adhesion
cfa04520  Adherens junction
cfa04530  Tight junction
cfa04611  Platelet activation
cfa04670  Leukocyte transendothelial migration
cfa04714  Thermogenesis
cfa04810  Regulation of actin cytoskeleton
cfa04919  Thyroid hormone signaling pathway
cfa04921  Oxytocin signaling pathway
cfa05100  Bacterial invasion of epithelial cells
cfa05132  Salmonella infection
cfa05135  Yersinia infection
cfa05164  Influenza A
cfa05205  Proteoglycans in cancer
cfa05225  Hepatocellular carcinoma
cfa05410  Hypertrophic cardiomyopathy (HCM)
cfa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cfa05414  Dilated cardiomyopathy (DCM)
cfa05416  Viral myocarditis
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    403580 (ACTB)
   04390 Hippo signaling pathway
    403580 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    403580 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    403580 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    403580 (ACTB)
   04520 Adherens junction
    403580 (ACTB)
   04530 Tight junction
    403580 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    403580 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    403580 (ACTB)
   04670 Leukocyte transendothelial migration
    403580 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    403580 (ACTB)
   04919 Thyroid hormone signaling pathway
    403580 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    403580 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    403580 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    403580 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    403580 (ACTB)
   05410 Hypertrophic cardiomyopathy (HCM)
    403580 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    403580 (ACTB)
   05414 Dilated cardiomyopathy (DCM)
    403580 (ACTB)
   05416 Viral myocarditis
    403580 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    403580 (ACTB)
   05135 Yersinia infection
    403580 (ACTB)
   05100 Bacterial invasion of epithelial cells
    403580 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    403580 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cfa03021]
    403580 (ACTB)
   03019 Messenger RNA biogenesis [BR:cfa03019]
    403580 (ACTB)
   03036 Chromosome and associated proteins [BR:cfa03036]
    403580 (ACTB)
   03029 Mitochondrial biogenesis [BR:cfa03029]
    403580 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cfa04812]
    403580 (ACTB)
   04147 Exosome [BR:cfa04147]
    403580 (ACTB)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     403580 (ACTB)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     403580 (ACTB)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     403580 (ACTB)
    NuA4 complex
     403580 (ACTB)
  Chromatin remodeling factors
   BAF complex
    403580 (ACTB)
   PBAF complex
    403580 (ACTB)
   SWR1 complex
    403580 (ACTB)
Mitochondrial biogenesis [BR:cfa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    403580 (ACTB)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     403580 (ACTB)
Exosome [BR:cfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   403580 (ACTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 403580
NCBI-ProteinID: NP_001182774
Ensembl: ENSCAFG00000016020
UniProt: O18840
LinkDB All DBs
Position
6
AA seq 375 aa AA seqDB search
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgatatcgctgcgcttgtggtcgacaacggctccggcatgtgcaaggccggc
ttcgcaggcgacgacgccccccgggccgtcttcccctccatcgtggggcgcccccggcac
cagggcgtgatggtgggcatgggccagaaggactcctacgtgggcgatgaggcccagagc
aagaggggcatcctgaccctgaagtaccccattgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggcccccgaggag
cacccggtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgacc
cagatcatgttcgagactttcaacaccccagccatgtacgtggccatccaggctgtgctg
tccctgtacgcctctggccgcaccactggcatcgtgatggactccggtgacggggtcacc
cacacggtgcccatctatgaggggtacgccctcccccatgccatcttgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcacggagcgtggctacagcttc
accaccaccgccgagcgggaaatcgtgcgtgacatcaaggagaagctgtgttatgtggcc
ctggacttcgagcaggagatggccaccgcggcctccagctcctccctggagaagagctat
gagctgcccgacgggcaggtcatcactattggcaacgagcggttccgctgcccagaggct
ctcttccagccttccttcctgggcatggaatcctgcggcatccatgaaactaccttcaac
tccatcatgaagtgtgacgttgacatccgcaaggacctctatgccaacacagtgctgtct
ggtggaaccaccatgtaccctggcatcgctgacaggatgcagaaggagatcactgccctg
gcacccagcacaatgaagatcaagatcatcgcaccccctgagcgcaagtactctgtgtgg
attgggggctccatcctggcctcactgtccaccttccagcaaatgtggatcagcaagcag
gagtacgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system