KEGG   Camelus ferus (Wild Bactrian camel): 102505690
Entry
102505690         CDS       T02979                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04070  Phosphatidylinositol signaling system
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04670  Leukocyte transendothelial migration
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04930  Type II diabetes mellitus
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr04960  Aldosterone-regulated sodium reabsorption
cfr04973  Carbohydrate digestion and absorption
cfr05010  Alzheimer disease
cfr05017  Spinocerebellar ataxia
cfr05020  Prion disease
cfr05100  Bacterial invasion of epithelial cells
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05146  Amoebiasis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102505690
   04014 Ras signaling pathway
    102505690
   04015 Rap1 signaling pathway
    102505690
   04370 VEGF signaling pathway
    102505690
   04630 JAK-STAT signaling pathway
    102505690
   04668 TNF signaling pathway
    102505690
   04066 HIF-1 signaling pathway
    102505690
   04068 FoxO signaling pathway
    102505690
   04070 Phosphatidylinositol signaling system
    102505690
   04072 Phospholipase D signaling pathway
    102505690
   04071 Sphingolipid signaling pathway
    102505690
   04024 cAMP signaling pathway
    102505690
   04151 PI3K-Akt signaling pathway
    102505690
   04152 AMPK signaling pathway
    102505690
   04150 mTOR signaling pathway
    102505690
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102505690
  09143 Cell growth and death
   04210 Apoptosis
    102505690
   04218 Cellular senescence
    102505690
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102505690
   04550 Signaling pathways regulating pluripotency of stem cells
    102505690
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102505690
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102505690
   04613 Neutrophil extracellular trap formation
    102505690
   04620 Toll-like receptor signaling pathway
    102505690
   04625 C-type lectin receptor signaling pathway
    102505690
   04650 Natural killer cell mediated cytotoxicity
    102505690
   04660 T cell receptor signaling pathway
    102505690
   04662 B cell receptor signaling pathway
    102505690
   04664 Fc epsilon RI signaling pathway
    102505690
   04666 Fc gamma R-mediated phagocytosis
    102505690
   04670 Leukocyte transendothelial migration
    102505690
   04062 Chemokine signaling pathway
    102505690
  09152 Endocrine system
   04910 Insulin signaling pathway
    102505690
   04923 Regulation of lipolysis in adipocytes
    102505690
   04929 GnRH secretion
    102505690
   04915 Estrogen signaling pathway
    102505690
   04914 Progesterone-mediated oocyte maturation
    102505690
   04917 Prolactin signaling pathway
    102505690
   04926 Relaxin signaling pathway
    102505690
   04935 Growth hormone synthesis, secretion and action
    102505690
   04919 Thyroid hormone signaling pathway
    102505690
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102505690
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102505690
  09156 Nervous system
   04725 Cholinergic synapse
    102505690
   04722 Neurotrophin signaling pathway
    102505690
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102505690
  09158 Development and regeneration
   04360 Axon guidance
    102505690
   04380 Osteoclast differentiation
    102505690
  09149 Aging
   04211 Longevity regulating pathway
    102505690
   04213 Longevity regulating pathway - multiple species
    102505690
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102505690
   05206 MicroRNAs in cancer
    102505690
   05205 Proteoglycans in cancer
    102505690
   05203 Viral carcinogenesis
    102505690
   05230 Central carbon metabolism in cancer
    102505690
   05231 Choline metabolism in cancer
    102505690
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102505690
  09162 Cancer: specific types
   05210 Colorectal cancer
    102505690
   05212 Pancreatic cancer
    102505690
   05225 Hepatocellular carcinoma
    102505690
   05226 Gastric cancer
    102505690
   05214 Glioma
    102505690
   05221 Acute myeloid leukemia
    102505690
   05220 Chronic myeloid leukemia
    102505690
   05218 Melanoma
    102505690
   05211 Renal cell carcinoma
    102505690
   05215 Prostate cancer
    102505690
   05213 Endometrial cancer
    102505690
   05224 Breast cancer
    102505690
   05222 Small cell lung cancer
    102505690
   05223 Non-small cell lung cancer
    102505690
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102505690
   05017 Spinocerebellar ataxia
    102505690
   05020 Prion disease
    102505690
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102505690
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102505690
   04932 Non-alcoholic fatty liver disease
    102505690
   04931 Insulin resistance
    102505690
   04933 AGE-RAGE signaling pathway in diabetic complications
    102505690
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102505690
   05100 Bacterial invasion of epithelial cells
    102505690
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102505690
   05170 Human immunodeficiency virus 1 infection
    102505690
   05161 Hepatitis B
    102505690
   05160 Hepatitis C
    102505690
   05171 Coronavirus disease - COVID-19
    102505690
   05164 Influenza A
    102505690
   05162 Measles
    102505690
   05168 Herpes simplex virus 1 infection
    102505690
   05163 Human cytomegalovirus infection
    102505690
   05167 Kaposi sarcoma-associated herpesvirus infection
    102505690
   05169 Epstein-Barr virus infection
    102505690
   05165 Human papillomavirus infection
    102505690
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102505690
   05142 Chagas disease
    102505690
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102505690
   01524 Platinum drug resistance
    102505690
   01522 Endocrine resistance
    102505690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102505690
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102505690
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 Mod_r DUF5638
Other DBs
NCBI-GeneID: 102505690
NCBI-ProteinID: XP_014409446
LinkDB
Position
13
AA seq 539 aa
MLSFVTSPPFSQRILFFSLSILPPSKDTKVASAERFGGGGSFSLESGCVEGILGKPLLTP
LLSAPQASLYLSEGKSRAMYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPP
KPMTSAVTNGMKESSVSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTL
TLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSR
YQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNET
IKIFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLK
KQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYF
INEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVK
HCVIYSTARGYGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgctttcctttgtcacttccccacctttctcccagcgcattctttttttctccctctcc
attctacccccgtcgaaggacacaaaagtggcttccgcggaaagatttggaggcggtggg
agtttttctctggagagcggctgtgtcgaagggattttggggaagccgcttttaacacct
ctgctctccgccccgcaagcctctctgtacctctccgaggggaaaagccgcgcgatgtac
aatacggtgtggagtatggaccgcgatgacgcagactggcgggaggtgatgatgccctat
tcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaagccacct
aagccaatgacttcagctgttacaaatggaatgaaggagagttctgtttctcttcaggat
gcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacgtgacatg
ccagatggtaccttcttggtcagagatgcctcaacaaaaatgcagggagattatactttg
actttgaggaagggaggcaataataagctaataaagatctatcatcgtgatggtaaatac
ggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactatcaccat
gaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtgtccaga
taccaacaggatcaattggtaaaagaagataacattgatgcagtaggtaaaaaactgcaa
gaataccactctcagtatcaggaaaagagtaaagaatatgacaggctatatgaagaatac
accagaacatcccaggaaatccagatgaagaggactgcaattgaagcttttaatgaaaca
attaaaatatttgaagagcagtgtcacacacaagaacaacatagcaaagaatatattgag
cgatttcggagagaggggaatgaaaaggaaattgaacgaattatgatgaattatgacaaa
ttgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggatttgaag
aaacaagctttggacaaccgggaaatagataaaaaaatgaacagtatcaaacctgacctg
atccagctgcgcaagatccgagatcagcacctcgtgtggctcaatcacaaaggagtgagg
cagaagcgtctaaatgcctggctgggaatcaagaatgaagatgctgatgagacctatttt
atcaatgaggaagatgaaaacctgccccactatgatgagaaaacctggtttgttgaggat
atcaaccgagtacaagcagaggacttgctttacgggaaacctgatggtgcattcttaatt
cgagagagtagcaagaaaggatgttacgcttgctctgtggtcgccgacggggaagtgaag
cactgtgtgatctacagcactgctcgcggctacggcttcgcggagccctacaacctgtac
ggctctctgaaggagctggtgctgcactaccagcacacgtccctggtccagcacaacgac
tccctcaacgtcaggctggcctaccccgtccacgcacagatgccctcgctctgcagataa

KEGG   Camelus ferus (Wild Bactrian camel): 102513205
Entry
102513205         CDS       T02979                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04070  Phosphatidylinositol signaling system
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04670  Leukocyte transendothelial migration
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04930  Type II diabetes mellitus
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr04960  Aldosterone-regulated sodium reabsorption
cfr04973  Carbohydrate digestion and absorption
cfr05010  Alzheimer disease
cfr05017  Spinocerebellar ataxia
cfr05020  Prion disease
cfr05100  Bacterial invasion of epithelial cells
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05146  Amoebiasis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102513205 (PIK3R2)
   04014 Ras signaling pathway
    102513205 (PIK3R2)
   04015 Rap1 signaling pathway
    102513205 (PIK3R2)
   04370 VEGF signaling pathway
    102513205 (PIK3R2)
   04630 JAK-STAT signaling pathway
    102513205 (PIK3R2)
   04668 TNF signaling pathway
    102513205 (PIK3R2)
   04066 HIF-1 signaling pathway
    102513205 (PIK3R2)
   04068 FoxO signaling pathway
    102513205 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    102513205 (PIK3R2)
   04072 Phospholipase D signaling pathway
    102513205 (PIK3R2)
   04071 Sphingolipid signaling pathway
    102513205 (PIK3R2)
   04024 cAMP signaling pathway
    102513205 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    102513205 (PIK3R2)
   04152 AMPK signaling pathway
    102513205 (PIK3R2)
   04150 mTOR signaling pathway
    102513205 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102513205 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    102513205 (PIK3R2)
   04218 Cellular senescence
    102513205 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102513205 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102513205 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102513205 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102513205 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    102513205 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    102513205 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    102513205 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    102513205 (PIK3R2)
   04660 T cell receptor signaling pathway
    102513205 (PIK3R2)
   04662 B cell receptor signaling pathway
    102513205 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    102513205 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    102513205 (PIK3R2)
   04670 Leukocyte transendothelial migration
    102513205 (PIK3R2)
   04062 Chemokine signaling pathway
    102513205 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102513205 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    102513205 (PIK3R2)
   04929 GnRH secretion
    102513205 (PIK3R2)
   04915 Estrogen signaling pathway
    102513205 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    102513205 (PIK3R2)
   04917 Prolactin signaling pathway
    102513205 (PIK3R2)
   04926 Relaxin signaling pathway
    102513205 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    102513205 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    102513205 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102513205 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102513205 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    102513205 (PIK3R2)
   04722 Neurotrophin signaling pathway
    102513205 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102513205 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    102513205 (PIK3R2)
   04380 Osteoclast differentiation
    102513205 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    102513205 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    102513205 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102513205 (PIK3R2)
   05206 MicroRNAs in cancer
    102513205 (PIK3R2)
   05205 Proteoglycans in cancer
    102513205 (PIK3R2)
   05203 Viral carcinogenesis
    102513205 (PIK3R2)
   05230 Central carbon metabolism in cancer
    102513205 (PIK3R2)
   05231 Choline metabolism in cancer
    102513205 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102513205 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102513205 (PIK3R2)
   05212 Pancreatic cancer
    102513205 (PIK3R2)
   05225 Hepatocellular carcinoma
    102513205 (PIK3R2)
   05226 Gastric cancer
    102513205 (PIK3R2)
   05214 Glioma
    102513205 (PIK3R2)
   05221 Acute myeloid leukemia
    102513205 (PIK3R2)
   05220 Chronic myeloid leukemia
    102513205 (PIK3R2)
   05218 Melanoma
    102513205 (PIK3R2)
   05211 Renal cell carcinoma
    102513205 (PIK3R2)
   05215 Prostate cancer
    102513205 (PIK3R2)
   05213 Endometrial cancer
    102513205 (PIK3R2)
   05224 Breast cancer
    102513205 (PIK3R2)
   05222 Small cell lung cancer
    102513205 (PIK3R2)
   05223 Non-small cell lung cancer
    102513205 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102513205 (PIK3R2)
   05017 Spinocerebellar ataxia
    102513205 (PIK3R2)
   05020 Prion disease
    102513205 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102513205 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102513205 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    102513205 (PIK3R2)
   04931 Insulin resistance
    102513205 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102513205 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102513205 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    102513205 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102513205 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    102513205 (PIK3R2)
   05161 Hepatitis B
    102513205 (PIK3R2)
   05160 Hepatitis C
    102513205 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    102513205 (PIK3R2)
   05164 Influenza A
    102513205 (PIK3R2)
   05162 Measles
    102513205 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    102513205 (PIK3R2)
   05163 Human cytomegalovirus infection
    102513205 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102513205 (PIK3R2)
   05169 Epstein-Barr virus infection
    102513205 (PIK3R2)
   05165 Human papillomavirus infection
    102513205 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102513205 (PIK3R2)
   05142 Chagas disease
    102513205 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102513205 (PIK3R2)
   01524 Platinum drug resistance
    102513205 (PIK3R2)
   01522 Endocrine resistance
    102513205 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102513205 (PIK3R2)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102513205 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e ATG11 Tai4
Other DBs
NCBI-GeneID: 102513205
NCBI-ProteinID: XP_032321142
LinkDB
Position
22
AA seq 723 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGSERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIDRTGLDSYRPEPPAARTDWSLSDMEQWDAATLSDGVKGFLLALPS
PLVTPEAAAEAHRALREAAGPVGPVLEPPTLPLHHALTLRFLLQHLGRVARRAPAPGPVV
RALGATFGPLLLRAPPPSPPPGGAPDGTEPIPDFPALLVEKLLQEHLEEQEVAPPALPPK
PPKAKPASTGLANGGNPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEY
TLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYPV
SKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFN
ETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQE
LRVQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQY
SLMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDT
KHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPP
AAR
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggctggggctgagggcttccaataccgtgctctgtacccattccgccgggaacggcca
gaggacctggagctgctgccaggtgatgtccttgtggtgagccgggcggccctacaggca
ctgggcgtggctgagggcagcgagcgttgcccacagagtgtgggctggatgcctggcctc
aacgagcgtacacggcagcgcggcgacttccctggcacctacgttgagttcctggggcct
gtggccctggcccggcctggccctcgcccacgtggcccccgcccgctgcccgccaggccc
cgagatgggccccctgagccaggcctcacactccctgacctacctgagcagttctcccca
cctgatgtggcgccccctatcctggtgaagcttgtggaggccattgatcggacagggcta
gacagctacagacctgagccacctgccgcacgcacagactggtccctaagtgacatggag
cagtgggacgcggcaaccctgtcagatggcgtgaagggcttcctgctagcgctgccctct
ccccttgtgacacctgaggccgcggccgaagcacatcgagccctgcgggaggccgcaggg
cccgtggggccagtgctggagcccccgacgctgccactgcaccacgcgctcacgctgcgc
ttcctgctccagcatctgggccgggtggcccggcgcgccccagcgccgggccccgtggtg
cgtgccctgggcgccaccttcgggccgctgctgctgcgtgcgccaccgccctcgccgcca
ccagggggcgcgcccgacgggactgagcccatccccgacttccctgctctgctggtggag
aagttgcttcaggaacatctggaggagcaggaggttgcgcccccagcactgccgcctaaa
ccccccaaggcaaagccggcctccacaggcctggccaatggggggaacccgccctccctg
caggatgctgaatggtactggggtgacatctccagggaggaggtaaacgagaaactccgg
gacacacctgatggtacctttctggtccgagatgcatccagcaagatccagggggagtac
acgctgacccttaggaaaggcgggaacaacaagctgatcaaggtcttccaccgagacggt
cactacggcttctcagagccgctcaccttctgctctgtcgtggacctcatcacccactac
cgccatgagtcactggcccagtacaatgccaagctggacactcggctcctctacccagtg
tccaagtaccagcaggaccagattgtcaaggaggacagcgtggaagcagtgggcgcccag
cttaaagtctatcaccagcagtaccaagacaagagccgcgagtacgaccagctctatgag
gagtacacacgcacctcccaggaactgcagatgaagcgcacagccatcgaggccttcaat
gagaccatcaagatctttgaagagcagggccagacgcaagagaagtgcagcaaggagtat
ctggagcgcttccggcgtgagggcaatgagaaggagatgcagaggatcctgctgaactcc
gagcggctcaagtctcgcattgctgagatccacgagagccgcacaaagctggagcaggag
ctacgggtgcaggcctctgacaaccgagagatcgacaagcgcatgaacagcctcaagcca
gacctcatgcagctgcgcaagatccgagaccagtaccttgtgtggctcactcagaaaggt
gcccggcagaagaaaatcaacgaatggttgggaatcaaaaacgagactgaggaccagtac
tcactgatggaagatgaggatgaccttccccaccatgaggaacgcacgtggtatgtaggc
aagatcaaccgcacacaagctgaggaaatgctgagtggcaagcgggatggcaccttcctc
atccgtgagagcagccagcgcggctgctacgcctgctccgtggtggtggatggtgacacc
aaacactgcgttatctaccgcacagccacgggcttcggctttgcagagccctataacttg
tacgggtcgctgaaggagctggtgctgcactaccagcatgcctcactggtgcagcacaac
gacgcgctcaccgtcacgctcgcccatcccgtgcgcgccccaggccccgggcccccacct
gccgcccgctga

KEGG   Camelus ferus (Wild Bactrian camel): 102518643
Entry
102518643         CDS       T02979                                 

Gene name
PIK3CD
Definition
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00562  Inositol phosphate metabolism
cfr01100  Metabolic pathways
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04070  Phosphatidylinositol signaling system
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04670  Leukocyte transendothelial migration
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04930  Type II diabetes mellitus
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr04960  Aldosterone-regulated sodium reabsorption
cfr04973  Carbohydrate digestion and absorption
cfr05010  Alzheimer disease
cfr05017  Spinocerebellar ataxia
cfr05020  Prion disease
cfr05100  Bacterial invasion of epithelial cells
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05146  Amoebiasis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102518643 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102518643 (PIK3CD)
   04014 Ras signaling pathway
    102518643 (PIK3CD)
   04015 Rap1 signaling pathway
    102518643 (PIK3CD)
   04370 VEGF signaling pathway
    102518643 (PIK3CD)
   04630 JAK-STAT signaling pathway
    102518643 (PIK3CD)
   04668 TNF signaling pathway
    102518643 (PIK3CD)
   04066 HIF-1 signaling pathway
    102518643 (PIK3CD)
   04068 FoxO signaling pathway
    102518643 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102518643 (PIK3CD)
   04072 Phospholipase D signaling pathway
    102518643 (PIK3CD)
   04071 Sphingolipid signaling pathway
    102518643 (PIK3CD)
   04024 cAMP signaling pathway
    102518643 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    102518643 (PIK3CD)
   04152 AMPK signaling pathway
    102518643 (PIK3CD)
   04150 mTOR signaling pathway
    102518643 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102518643 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    102518643 (PIK3CD)
   04218 Cellular senescence
    102518643 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102518643 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    102518643 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102518643 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102518643 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    102518643 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    102518643 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    102518643 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    102518643 (PIK3CD)
   04660 T cell receptor signaling pathway
    102518643 (PIK3CD)
   04662 B cell receptor signaling pathway
    102518643 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    102518643 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    102518643 (PIK3CD)
   04670 Leukocyte transendothelial migration
    102518643 (PIK3CD)
   04062 Chemokine signaling pathway
    102518643 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102518643 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    102518643 (PIK3CD)
   04929 GnRH secretion
    102518643 (PIK3CD)
   04915 Estrogen signaling pathway
    102518643 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102518643 (PIK3CD)
   04917 Prolactin signaling pathway
    102518643 (PIK3CD)
   04926 Relaxin signaling pathway
    102518643 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    102518643 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    102518643 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102518643 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102518643 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    102518643 (PIK3CD)
   04722 Neurotrophin signaling pathway
    102518643 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102518643 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    102518643 (PIK3CD)
   04380 Osteoclast differentiation
    102518643 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    102518643 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    102518643 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102518643 (PIK3CD)
   05206 MicroRNAs in cancer
    102518643 (PIK3CD)
   05205 Proteoglycans in cancer
    102518643 (PIK3CD)
   05203 Viral carcinogenesis
    102518643 (PIK3CD)
   05230 Central carbon metabolism in cancer
    102518643 (PIK3CD)
   05231 Choline metabolism in cancer
    102518643 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102518643 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102518643 (PIK3CD)
   05212 Pancreatic cancer
    102518643 (PIK3CD)
   05225 Hepatocellular carcinoma
    102518643 (PIK3CD)
   05226 Gastric cancer
    102518643 (PIK3CD)
   05214 Glioma
    102518643 (PIK3CD)
   05221 Acute myeloid leukemia
    102518643 (PIK3CD)
   05220 Chronic myeloid leukemia
    102518643 (PIK3CD)
   05218 Melanoma
    102518643 (PIK3CD)
   05211 Renal cell carcinoma
    102518643 (PIK3CD)
   05215 Prostate cancer
    102518643 (PIK3CD)
   05213 Endometrial cancer
    102518643 (PIK3CD)
   05224 Breast cancer
    102518643 (PIK3CD)
   05222 Small cell lung cancer
    102518643 (PIK3CD)
   05223 Non-small cell lung cancer
    102518643 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102518643 (PIK3CD)
   05017 Spinocerebellar ataxia
    102518643 (PIK3CD)
   05020 Prion disease
    102518643 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102518643 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102518643 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    102518643 (PIK3CD)
   04931 Insulin resistance
    102518643 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102518643 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102518643 (PIK3CD)
   05135 Yersinia infection
    102518643 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    102518643 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102518643 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    102518643 (PIK3CD)
   05161 Hepatitis B
    102518643 (PIK3CD)
   05160 Hepatitis C
    102518643 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    102518643 (PIK3CD)
   05164 Influenza A
    102518643 (PIK3CD)
   05162 Measles
    102518643 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    102518643 (PIK3CD)
   05163 Human cytomegalovirus infection
    102518643 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102518643 (PIK3CD)
   05169 Epstein-Barr virus infection
    102518643 (PIK3CD)
   05165 Human papillomavirus infection
    102518643 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102518643 (PIK3CD)
   05142 Chagas disease
    102518643 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102518643 (PIK3CD)
   01524 Platinum drug resistance
    102518643 (PIK3CD)
   01522 Endocrine resistance
    102518643 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102518643 (PIK3CD)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102518643 (PIK3CD)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102518643 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 102518643
NCBI-ProteinID: XP_032351032
LinkDB
Position
13
AA seq 1044 aa
MPPGVDCPMEFWTKEENQDVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLQDPEVNDFRAKMRQFCEEAAVRRQQLSWEAWLQYSFPLQLEPSARSWGP
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LRVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPASQVQKPR
TKPPPIPMKKPSSVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECRLYMWPSVPDEKGELLNPSGTVRSNPNTESAAALVIFLPEVAP
HPVYYPALDKILELGRHGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEIQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTPKPQTKELMHMCMR
QETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
VRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYSILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaagaggagaatcaggacgtg
gcagttgacttcttgctgcccacgggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcaccatcaagaaggttttgtggcaccgagcccagtatgagccgctcttccac
atgctcagtgaccccgaggcctatgtgttcacctgcgtcaaccagaccgcagagcagcag
gagctggaggacgagcagcggcggctgtgtgacatccagcccttcctgcccgtcctgcgc
ctggtggcccgcgagggggacagagtgaagaagctcatcaactcccagatcagcctgctc
attggcaaaggcctccatgagtttgactccttgcaagacccggaagtgaatgactttcga
gccaagatgcgccagttctgtgaggaggcagctgtgcggagacagcagctgagctgggag
gcctggctgcagtacagcttcccgctgcagctggagccttcagcacggagctgggggcca
ggcaccctgcgcgtccccaaccgggccctcctggtcaacgtcaagttcgagggtagtgag
gagagcttcaccttccaggtgtccaccaaggatgtgcccctggcactgatggcctgcgcc
ctccggaagaaggccacagtgttccggcagccgctggtggagcagcctgaggactacacg
ctgcgagtgaacgggaggcatgagtacctgtacggcagctaccccctctgccagttccag
tacatctgtagctgcctgcacagcgggctgaccccgcacctgaccatggtgcactcctcc
tccatcctcgccatgcgggacgaacagagcaaccctgcctcccaagtccaaaaaccgcgc
accaagccgccccccattcccatgaagaagccttcctcagtgtctctgtggtccctggag
cagcctttctgcatcgagctgatccagggcagcaaagtgaatgcagatgagcggatgaag
ctggtggtgcaggccgggctcttccatggcaacgagacactgtgcaagacggtgtccagc
tcagaggtgagcgtgtgctcagaacccgtatggaagcagcggctggagttcgacatcaat
gtgtgcgacctgccgcgcatggcccgcctctgctttgcactttatgccgtgattgagaag
gccaagaaggcgcgctctaccaagaagaagtccaagaaggcggactgccccatcgcgtgg
gccaacctcatgttgtttgactacaaggaccagctcaagaccggcgagtgccgcctctac
atgtggccctccgtcccagatgagaaaggggagctgctgaacccctcgggaactgtgcgg
agtaatcccaacactgagagtgcagccgctctggtcatctttctccctgaggtggccccc
caccctgtgtactaccctgccctggacaagatcctggagctggggcggcacggggagcat
gggcgcttcacggaggaggagcagctgcagctgcgggaaatcctggagcggcggggatcc
ggggagctgtatgagcacgagaaggacctggtgtggaagatgcggcacgagatccaggag
cacttccccgaggcgctggcccggctgctgctggtcaccaagtggaacaaacatgaggac
gtggcccagatgctctacctgctgtgctcctggcctgagctgcctgtcctgagtgccctg
gagctgctggacttcagcttccccgaccgccacgtgggctccttcgccatcaagtccctg
cggaaactgacggacgacgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctcgactgcgagctgaccaagttcctgctggaccgggccctggccaac
cgcaagatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtctgtg
gccctgcgcttcggcctcatcatggaggcctactgccggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagctctgagcaaactgaaggccctgaacgactttgtcaaa
gtgagctcccagaagacgcccaagccgcagaccaaggagctgatgcacatgtgcatgcgc
caggagacctacctggaggccctctcccacctgcagtccccgctcgaccccagcaccctg
ctggctgaagtctgtgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
gtcatgtacagcaacgaggaggccggcagtgacggcagcgtgggcatcatcttcaagaac
ggggatgacctccgccaggacatgctgaccctgcagatgatccagctcatggacattctg
tggaagcaggaggggttggacctgaggatgaccccctatggctgcctctccaccggggac
cgcacaggcctcatcgaggtcgttcttcactcggacaccatcgccaacatccagctgaac
aagagcaacatggcggccacagctgccttcaacaaagatgctctactcaactggctcaag
tccaagaaccctggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctactgcgtggccacgtacgtgctgggcatcggtgatcggcacagcgacaacatcatg
gtccgggagaacggccagcttttccacattgatttcggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgagtcccattcatcctcacctatgactttgtccac
gtgatccagcaggggaagactaataatagtgagaaatttgaaaggttccggggctactgt
gagagggcctactccatcctgcggcggcacgggctgctcttcctccacctcttcgccctc
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtatctcaaggat
tctctggccttgggaaaaacagaggaggaggctctgaagcacttccgagtgaagtttaac
gaagccctccgggagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacagacaatag

KEGG   Camelus ferus (Wild Bactrian camel): 102519994
Entry
102519994         CDS       T02979                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00562  Inositol phosphate metabolism
cfr01100  Metabolic pathways
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04070  Phosphatidylinositol signaling system
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04670  Leukocyte transendothelial migration
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04930  Type II diabetes mellitus
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr04960  Aldosterone-regulated sodium reabsorption
cfr04973  Carbohydrate digestion and absorption
cfr05010  Alzheimer disease
cfr05017  Spinocerebellar ataxia
cfr05020  Prion disease
cfr05100  Bacterial invasion of epithelial cells
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05146  Amoebiasis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102519994 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102519994 (PIK3CB)
   04014 Ras signaling pathway
    102519994 (PIK3CB)
   04015 Rap1 signaling pathway
    102519994 (PIK3CB)
   04370 VEGF signaling pathway
    102519994 (PIK3CB)
   04630 JAK-STAT signaling pathway
    102519994 (PIK3CB)
   04668 TNF signaling pathway
    102519994 (PIK3CB)
   04066 HIF-1 signaling pathway
    102519994 (PIK3CB)
   04068 FoxO signaling pathway
    102519994 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102519994 (PIK3CB)
   04072 Phospholipase D signaling pathway
    102519994 (PIK3CB)
   04071 Sphingolipid signaling pathway
    102519994 (PIK3CB)
   04024 cAMP signaling pathway
    102519994 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    102519994 (PIK3CB)
   04152 AMPK signaling pathway
    102519994 (PIK3CB)
   04150 mTOR signaling pathway
    102519994 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102519994 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    102519994 (PIK3CB)
   04218 Cellular senescence
    102519994 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102519994 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    102519994 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102519994 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102519994 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    102519994 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    102519994 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102519994 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    102519994 (PIK3CB)
   04660 T cell receptor signaling pathway
    102519994 (PIK3CB)
   04662 B cell receptor signaling pathway
    102519994 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    102519994 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    102519994 (PIK3CB)
   04670 Leukocyte transendothelial migration
    102519994 (PIK3CB)
   04062 Chemokine signaling pathway
    102519994 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102519994 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    102519994 (PIK3CB)
   04929 GnRH secretion
    102519994 (PIK3CB)
   04915 Estrogen signaling pathway
    102519994 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102519994 (PIK3CB)
   04917 Prolactin signaling pathway
    102519994 (PIK3CB)
   04926 Relaxin signaling pathway
    102519994 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    102519994 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    102519994 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102519994 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102519994 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    102519994 (PIK3CB)
   04722 Neurotrophin signaling pathway
    102519994 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102519994 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102519994 (PIK3CB)
   04380 Osteoclast differentiation
    102519994 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    102519994 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    102519994 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102519994 (PIK3CB)
   05206 MicroRNAs in cancer
    102519994 (PIK3CB)
   05205 Proteoglycans in cancer
    102519994 (PIK3CB)
   05203 Viral carcinogenesis
    102519994 (PIK3CB)
   05230 Central carbon metabolism in cancer
    102519994 (PIK3CB)
   05231 Choline metabolism in cancer
    102519994 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102519994 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102519994 (PIK3CB)
   05212 Pancreatic cancer
    102519994 (PIK3CB)
   05225 Hepatocellular carcinoma
    102519994 (PIK3CB)
   05226 Gastric cancer
    102519994 (PIK3CB)
   05214 Glioma
    102519994 (PIK3CB)
   05221 Acute myeloid leukemia
    102519994 (PIK3CB)
   05220 Chronic myeloid leukemia
    102519994 (PIK3CB)
   05218 Melanoma
    102519994 (PIK3CB)
   05211 Renal cell carcinoma
    102519994 (PIK3CB)
   05215 Prostate cancer
    102519994 (PIK3CB)
   05213 Endometrial cancer
    102519994 (PIK3CB)
   05224 Breast cancer
    102519994 (PIK3CB)
   05222 Small cell lung cancer
    102519994 (PIK3CB)
   05223 Non-small cell lung cancer
    102519994 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102519994 (PIK3CB)
   05017 Spinocerebellar ataxia
    102519994 (PIK3CB)
   05020 Prion disease
    102519994 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102519994 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102519994 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    102519994 (PIK3CB)
   04931 Insulin resistance
    102519994 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102519994 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102519994 (PIK3CB)
   05135 Yersinia infection
    102519994 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    102519994 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102519994 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    102519994 (PIK3CB)
   05161 Hepatitis B
    102519994 (PIK3CB)
   05160 Hepatitis C
    102519994 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    102519994 (PIK3CB)
   05164 Influenza A
    102519994 (PIK3CB)
   05162 Measles
    102519994 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    102519994 (PIK3CB)
   05163 Human cytomegalovirus infection
    102519994 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102519994 (PIK3CB)
   05169 Epstein-Barr virus infection
    102519994 (PIK3CB)
   05165 Human papillomavirus infection
    102519994 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102519994 (PIK3CB)
   05142 Chagas disease
    102519994 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102519994 (PIK3CB)
   01524 Platinum drug resistance
    102519994 (PIK3CB)
   01522 Endocrine resistance
    102519994 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102519994 (PIK3CB)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102519994 (PIK3CB)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102519994 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 102519994
NCBI-ProteinID: XP_006177534
LinkDB
Position
1
AA seq 1070 aa
MCFHSIMPPAMADILDIWAVDSQIGSDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSILENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRSTIHGKEDE
VSPHDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFHIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASNDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVMLSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttccactccataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagataggatctgatggctccatacctgtggacttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcctatattaaacagatgttatgg
aaacaagttcacaattacccaatgtttaacctccttatggaaattgattcctatatgttt
gcatgtgtgaatcagactgctgtgtacgaggagctcgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggcagaggtctgcatgaatttgatgccttg
aaggatcctgaagttaatgaattccgaataaaaatgcgcaaattcagtgaggaaaagatt
cagtcgcttgtgggattgtcttggatggattggctaaagcagacctatccaccagagcat
gaaccatccatccttgagaatttagaagataagctttatggaggaaagcttattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaagtatctcctaacatgaatcct
atcaaaataaatgaattggcaatccaaaaacgttcgactattcatgggaaagaagatgaa
gttagcccccatgactatgtgttgcaagtcagtgggagagtagagtatgtgtttggtgat
caccccctaattcagttccagtatatccggaactgtgtgatgaacaggaccttgccccat
tttatacttgtggaatgttgcaagatcaagaagctgtacgaacaggaaatgattgccatc
gaggccgccataaatcgaaattcgtctaaccttcctcttcctttaccaccaaagaaaact
cgaattatttctcatgtttgggaaaataacaaccctttccacattgtcttggttaaggga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggctggcctttttcatggt
actgaactcctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccactggaatttgatatcaatacttgtgacctgccacggatggctcgatta
tgttttgctgtttatgcagttttggataaagtcaaaacgaagaaatcaactaaaactatt
aatccctctaaatatcagaccatcaggaaatctggaaaagtgcattatcctgtagcgtgg
gtaaatacaatggtttttgactttaaaggacagttgagatctggagatataatactgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcag
acaaatccatatactgaaaatgcaacagctttgcacatcaaatttccagagaataaaaag
caaccttattactaccctccttttgataagattattgaaaaggcagctgagattgcaagc
aatgatagtgctaatgtgtcaagtcgaggtggaaagaagtttcttgctgtactgaaagaa
atcttggacagggatccattgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacagtcattgccaaaattactgctgtcaatc
aagtggaataagcttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccccgggaggccctggagcttctcgatttcaactatccagatcagtacgtgcga
gaatatgcagtgggctgcctgcgacagatgagtgatgaagaactctctcaatatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctctccagattccta
ttagaaagagcacttgctaatcggaggatagggcagtttctattttggcaccttaggtca
gaagtgcacattcctgctgtctcagtacagtttggtgtcatccttgaagcatactgtcgg
ggaagtgtaggtcacatgaaagcactttccaagcaggttgaagcactcaataaattaaaa
actttaaatagtctaatcaaactgaatgcagtgaagctaaatagagccaaagggaaggag
gccatgcacacttgtttaaaacagaatgcttaccgggaagccctttctgacctgcagtca
cctctgaacccgtgtgtcatgctctcagaactctatgttgaaaagtgtaaatacatggat
tccaaaatgaagcccttgtggctggtgtacaacaacaaggtgtttggagaggattcagtt
ggagtgatttttaaaaatggtgatgatttacggcaagatatgttgactctccaaatgctg
cgcttgatggatttactctggaaagaagctggtctggatcttcggatgttgccttacggc
tgtttagcaacaggagaccgctccggcctcattgaagttgtgagcacctctgaaacaatc
gctgacattcagctaaacagtagcaatgtggctgctgcagcagccttcaacaaagacgcc
cttctgaactggcttaaagagtacaattctggggatgacctggaccgagccattgaggag
tttaccctgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaaccggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acctatgacttcattcatgtgattcagcaaggaaaaacaggaaacacagaaaagtttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgacggcatgggaatctcttc
atcactctctttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Camelus ferus (Wild Bactrian camel): 102520923
Entry
102520923         CDS       T02979                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04070  Phosphatidylinositol signaling system
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04670  Leukocyte transendothelial migration
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04930  Type II diabetes mellitus
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr04960  Aldosterone-regulated sodium reabsorption
cfr04973  Carbohydrate digestion and absorption
cfr05010  Alzheimer disease
cfr05017  Spinocerebellar ataxia
cfr05020  Prion disease
cfr05100  Bacterial invasion of epithelial cells
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05146  Amoebiasis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102520923 (PIK3R1)
   04014 Ras signaling pathway
    102520923 (PIK3R1)
   04015 Rap1 signaling pathway
    102520923 (PIK3R1)
   04370 VEGF signaling pathway
    102520923 (PIK3R1)
   04630 JAK-STAT signaling pathway
    102520923 (PIK3R1)
   04668 TNF signaling pathway
    102520923 (PIK3R1)
   04066 HIF-1 signaling pathway
    102520923 (PIK3R1)
   04068 FoxO signaling pathway
    102520923 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    102520923 (PIK3R1)
   04072 Phospholipase D signaling pathway
    102520923 (PIK3R1)
   04071 Sphingolipid signaling pathway
    102520923 (PIK3R1)
   04024 cAMP signaling pathway
    102520923 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    102520923 (PIK3R1)
   04152 AMPK signaling pathway
    102520923 (PIK3R1)
   04150 mTOR signaling pathway
    102520923 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102520923 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    102520923 (PIK3R1)
   04218 Cellular senescence
    102520923 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102520923 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102520923 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102520923 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102520923 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    102520923 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    102520923 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    102520923 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    102520923 (PIK3R1)
   04660 T cell receptor signaling pathway
    102520923 (PIK3R1)
   04662 B cell receptor signaling pathway
    102520923 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    102520923 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    102520923 (PIK3R1)
   04670 Leukocyte transendothelial migration
    102520923 (PIK3R1)
   04062 Chemokine signaling pathway
    102520923 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102520923 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    102520923 (PIK3R1)
   04929 GnRH secretion
    102520923 (PIK3R1)
   04915 Estrogen signaling pathway
    102520923 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    102520923 (PIK3R1)
   04917 Prolactin signaling pathway
    102520923 (PIK3R1)
   04926 Relaxin signaling pathway
    102520923 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    102520923 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    102520923 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102520923 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102520923 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    102520923 (PIK3R1)
   04722 Neurotrophin signaling pathway
    102520923 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102520923 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    102520923 (PIK3R1)
   04380 Osteoclast differentiation
    102520923 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    102520923 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    102520923 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102520923 (PIK3R1)
   05206 MicroRNAs in cancer
    102520923 (PIK3R1)
   05205 Proteoglycans in cancer
    102520923 (PIK3R1)
   05203 Viral carcinogenesis
    102520923 (PIK3R1)
   05230 Central carbon metabolism in cancer
    102520923 (PIK3R1)
   05231 Choline metabolism in cancer
    102520923 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102520923 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102520923 (PIK3R1)
   05212 Pancreatic cancer
    102520923 (PIK3R1)
   05225 Hepatocellular carcinoma
    102520923 (PIK3R1)
   05226 Gastric cancer
    102520923 (PIK3R1)
   05214 Glioma
    102520923 (PIK3R1)
   05221 Acute myeloid leukemia
    102520923 (PIK3R1)
   05220 Chronic myeloid leukemia
    102520923 (PIK3R1)
   05218 Melanoma
    102520923 (PIK3R1)
   05211 Renal cell carcinoma
    102520923 (PIK3R1)
   05215 Prostate cancer
    102520923 (PIK3R1)
   05213 Endometrial cancer
    102520923 (PIK3R1)
   05224 Breast cancer
    102520923 (PIK3R1)
   05222 Small cell lung cancer
    102520923 (PIK3R1)
   05223 Non-small cell lung cancer
    102520923 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102520923 (PIK3R1)
   05017 Spinocerebellar ataxia
    102520923 (PIK3R1)
   05020 Prion disease
    102520923 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102520923 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102520923 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    102520923 (PIK3R1)
   04931 Insulin resistance
    102520923 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102520923 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102520923 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    102520923 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102520923 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    102520923 (PIK3R1)
   05161 Hepatitis B
    102520923 (PIK3R1)
   05160 Hepatitis C
    102520923 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    102520923 (PIK3R1)
   05164 Influenza A
    102520923 (PIK3R1)
   05162 Measles
    102520923 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    102520923 (PIK3R1)
   05163 Human cytomegalovirus infection
    102520923 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102520923 (PIK3R1)
   05169 Epstein-Barr virus infection
    102520923 (PIK3R1)
   05165 Human papillomavirus infection
    102520923 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102520923 (PIK3R1)
   05142 Chagas disease
    102520923 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102520923 (PIK3R1)
   01524 Platinum drug resistance
    102520923 (PIK3R1)
   01522 Endocrine resistance
    102520923 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102520923 (PIK3R1)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102520923 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 AAA_13 DUF4201 Laminin_I Lant_dehydr_C Mod_r PI_PP_I Transcrip_act
Other DBs
NCBI-GeneID: 102520923
NCBI-ProteinID: XP_006185241
LinkDB
Position
3
AA seq 454 aa
MYNTVWNMEELDLDYAKTDINCGTDLMFYIEMDPPALPPKPPKPTTVANNGMNNNMSLQD
AEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKY
GFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLH
EYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIE
KFKREGNEKEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDL
IQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN
RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYGS
LKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtacaacactgtttggaatatggaagagctggatttagactatgctaagacagatata
aattgtggcacagacttgatgttttatatagaaatggatccaccagcactgcctcctaaa
ccaccaaaacccactactgtagccaacaacggtatgaataacaatatgtccttacaagat
gctgaatggtactggggcgatatctcgagggaagaagtgaatgaaaaacttcgagataca
gccgacgggacctttttggtacgagatgcgtctactaaaatgcatggtgattatactctt
acactaaggaaaggaggaaataacaaattaatcaaaatatttcaccgagatgggaaatat
ggcttctctgacccattaaccttcaattctgtggttgaactaataaaccactaccggaat
gaatctctagctcagtataatcccaaactggatgtgaaattactgtatccagtgtccaaa
taccaacaggatcaagttgtcaaagaagataatattgaagctgtagggaaaaaattacat
gaatataacactcaatttcaagaaaagagtcgggaatatgatagattatatgaagattat
acccgtacttcccaggaaatccaaatgaaaagaacagctattgaagcatttaatgaaact
ataaaaatatttgaagaacagtgccaaactcaggagcggtacagcaaagaatacatagag
aagtttaaacgtgaaggcaatgagaaagaaatacaaaggattatgcataattatgaaaaa
ttaaagtctcgaatcagtgaaattgtcgacagcaggcgaaggctggaggaggacttgaag
aagcaggcggccgagtaccgcgagattgacaagcgcatgaacagcattaaacccgacctt
attcagctgagaaagaccagagaccaatacttgatgtggttgactcagaaaggtgttcgg
cagaagaagctgaatgagtggctgggcaatgagaacactgaagaccaatattcgctggtg
gaagatgacgaggacttgccccaccacgatgagaagacctggaacgtgggaagcagcaac
cgaaacaaagccgaaaacctactgcgggggaaacgagacggaacttttctggtccgggaa
agcagtaaacagggctgctacgcctgctctgtggtggtggacggcgaggtcaagcactgc
gtcatcaacaagacggccacgggctacggcttcgcggagccctacaacctgtacggctcc
ctcaaggagctggtgctccactaccagcacacgtccctcgtgcagcacaacgactccctc
aacgtcacactggcctacccggtgtacgcgcaacagcggcgatga

KEGG   Camelus ferus (Wild Bactrian camel): 102523502
Entry
102523502         CDS       T02979                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00562  Inositol phosphate metabolism
cfr01100  Metabolic pathways
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04070  Phosphatidylinositol signaling system
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04670  Leukocyte transendothelial migration
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04930  Type II diabetes mellitus
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr04960  Aldosterone-regulated sodium reabsorption
cfr04973  Carbohydrate digestion and absorption
cfr05010  Alzheimer disease
cfr05017  Spinocerebellar ataxia
cfr05020  Prion disease
cfr05100  Bacterial invasion of epithelial cells
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05146  Amoebiasis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102523502 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102523502 (PIK3CA)
   04014 Ras signaling pathway
    102523502 (PIK3CA)
   04015 Rap1 signaling pathway
    102523502 (PIK3CA)
   04370 VEGF signaling pathway
    102523502 (PIK3CA)
   04630 JAK-STAT signaling pathway
    102523502 (PIK3CA)
   04668 TNF signaling pathway
    102523502 (PIK3CA)
   04066 HIF-1 signaling pathway
    102523502 (PIK3CA)
   04068 FoxO signaling pathway
    102523502 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102523502 (PIK3CA)
   04072 Phospholipase D signaling pathway
    102523502 (PIK3CA)
   04071 Sphingolipid signaling pathway
    102523502 (PIK3CA)
   04024 cAMP signaling pathway
    102523502 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    102523502 (PIK3CA)
   04152 AMPK signaling pathway
    102523502 (PIK3CA)
   04150 mTOR signaling pathway
    102523502 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102523502 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    102523502 (PIK3CA)
   04218 Cellular senescence
    102523502 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102523502 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    102523502 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102523502 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102523502 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    102523502 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    102523502 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    102523502 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    102523502 (PIK3CA)
   04660 T cell receptor signaling pathway
    102523502 (PIK3CA)
   04662 B cell receptor signaling pathway
    102523502 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    102523502 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    102523502 (PIK3CA)
   04670 Leukocyte transendothelial migration
    102523502 (PIK3CA)
   04062 Chemokine signaling pathway
    102523502 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102523502 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    102523502 (PIK3CA)
   04929 GnRH secretion
    102523502 (PIK3CA)
   04915 Estrogen signaling pathway
    102523502 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102523502 (PIK3CA)
   04917 Prolactin signaling pathway
    102523502 (PIK3CA)
   04926 Relaxin signaling pathway
    102523502 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    102523502 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    102523502 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102523502 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102523502 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    102523502 (PIK3CA)
   04722 Neurotrophin signaling pathway
    102523502 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102523502 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102523502 (PIK3CA)
   04380 Osteoclast differentiation
    102523502 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    102523502 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    102523502 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102523502 (PIK3CA)
   05206 MicroRNAs in cancer
    102523502 (PIK3CA)
   05205 Proteoglycans in cancer
    102523502 (PIK3CA)
   05203 Viral carcinogenesis
    102523502 (PIK3CA)
   05230 Central carbon metabolism in cancer
    102523502 (PIK3CA)
   05231 Choline metabolism in cancer
    102523502 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102523502 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102523502 (PIK3CA)
   05212 Pancreatic cancer
    102523502 (PIK3CA)
   05225 Hepatocellular carcinoma
    102523502 (PIK3CA)
   05226 Gastric cancer
    102523502 (PIK3CA)
   05214 Glioma
    102523502 (PIK3CA)
   05221 Acute myeloid leukemia
    102523502 (PIK3CA)
   05220 Chronic myeloid leukemia
    102523502 (PIK3CA)
   05218 Melanoma
    102523502 (PIK3CA)
   05211 Renal cell carcinoma
    102523502 (PIK3CA)
   05215 Prostate cancer
    102523502 (PIK3CA)
   05213 Endometrial cancer
    102523502 (PIK3CA)
   05224 Breast cancer
    102523502 (PIK3CA)
   05222 Small cell lung cancer
    102523502 (PIK3CA)
   05223 Non-small cell lung cancer
    102523502 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102523502 (PIK3CA)
   05017 Spinocerebellar ataxia
    102523502 (PIK3CA)
   05020 Prion disease
    102523502 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102523502 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102523502 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    102523502 (PIK3CA)
   04931 Insulin resistance
    102523502 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102523502 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102523502 (PIK3CA)
   05135 Yersinia infection
    102523502 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    102523502 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102523502 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    102523502 (PIK3CA)
   05161 Hepatitis B
    102523502 (PIK3CA)
   05160 Hepatitis C
    102523502 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    102523502 (PIK3CA)
   05164 Influenza A
    102523502 (PIK3CA)
   05162 Measles
    102523502 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    102523502 (PIK3CA)
   05163 Human cytomegalovirus infection
    102523502 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102523502 (PIK3CA)
   05169 Epstein-Barr virus infection
    102523502 (PIK3CA)
   05165 Human papillomavirus infection
    102523502 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102523502 (PIK3CA)
   05142 Chagas disease
    102523502 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102523502 (PIK3CA)
   01524 Platinum drug resistance
    102523502 (PIK3CA)
   01522 Endocrine resistance
    102523502 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102523502 (PIK3CA)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102523502 (PIK3CA)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102523502 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 102523502
NCBI-ProteinID: XP_032339785
LinkDB
Position
1
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacatttttgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtatgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaacgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtcatagtttctcca
aataatgacaaacaaaagtatactctgaaaatcaaccacgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaataccagggcaagtatatattaaaagtgtgtggatgtgacgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatctgatgctgatggctaaagaaagcctctactctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatctccacagctacaccatatatgaatgga
gagacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggaggggaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccagatggaatgaatggctgaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactcttgtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactgggtcaaatccaaataaagaaactccttgcttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aacgaattaagagaaaatgataaagaacagctccgagcaatttgtacacgagatcctcta
tctgaaatcactgagcaggagaaggattttctgtggagccacaggcactattgtgtaact
attcctgaaattctacccaaattgcttctgtctgtcaaatggaattctagagatgaagta
gctcagatgtattgcttggtaaaagactggcctccaatcaaacctgaacaggctatggag
cttctggactgcaattacccagatcctatggttcgaagttttgctgttagatgtttggaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaaaaaagcattgactaat
caaaggatcgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcatgtggaatgtatttgaag
cacctgaataggcaagttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaaaaaggatgaaacgcaaaaggtacagatgaaatttttagttgagcaaatgcgg
cgaccagatttcatggatgctctacagggctttctgtcccctctaaaccctgctcatcaa
ctgggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactctgg
ttgaattgggagaacccagacatcatgtcagaattactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgttaacacttcagattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
attggtgactgtgtgggacttattgaggtggtgagaaattctcacactattatgcaaatt
cagtgcaaaggcggcctgaaaggtgcactgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaagggagaaatatatgatgcagccattgatctttttacacgttcg
tgtgctggatattgtgttgctactttcattttggggattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaattgtttcatatagattttggacactttctggatcac
aagaagaaaaaatttggttataaacgagagcgtgtaccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaggaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tatattcgaaagaccctagctttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaaacagcatgctttgaactga

DBGET integrated database retrieval system