KEGG   Camelus ferus (Wild Bactrian camel): 102511209
Entry
102511209         CDS       T02979                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2 isoform X1
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04218  Cellular senescence
cfr04270  Vascular smooth muscle contraction
cfr04370  VEGF signaling pathway
cfr04371  Apelin signaling pathway
cfr04540  Gap junction
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04720  Long-term potentiation
cfr04722  Neurotrophin signaling pathway
cfr04730  Long-term depression
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04912  GnRH signaling pathway
cfr04915  Estrogen signaling pathway
cfr04916  Melanogenesis
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04934  Cushing syndrome
cfr04935  Growth hormone synthesis, secretion and action
cfr05010  Alzheimer disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05216  Thyroid cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102511209 (MAP2K2)
   04012 ErbB signaling pathway
    102511209 (MAP2K2)
   04014 Ras signaling pathway
    102511209 (MAP2K2)
   04015 Rap1 signaling pathway
    102511209 (MAP2K2)
   04370 VEGF signaling pathway
    102511209 (MAP2K2)
   04371 Apelin signaling pathway
    102511209 (MAP2K2)
   04066 HIF-1 signaling pathway
    102511209 (MAP2K2)
   04068 FoxO signaling pathway
    102511209 (MAP2K2)
   04072 Phospholipase D signaling pathway
    102511209 (MAP2K2)
   04071 Sphingolipid signaling pathway
    102511209 (MAP2K2)
   04024 cAMP signaling pathway
    102511209 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    102511209 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    102511209 (MAP2K2)
   04150 mTOR signaling pathway
    102511209 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102511209 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    102511209 (MAP2K2)
   04218 Cellular senescence
    102511209 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102511209 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102511209 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102511209 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102511209 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    102511209 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    102511209 (MAP2K2)
   04660 T cell receptor signaling pathway
    102511209 (MAP2K2)
   04662 B cell receptor signaling pathway
    102511209 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    102511209 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102511209 (MAP2K2)
   04929 GnRH secretion
    102511209 (MAP2K2)
   04912 GnRH signaling pathway
    102511209 (MAP2K2)
   04915 Estrogen signaling pathway
    102511209 (MAP2K2)
   04917 Prolactin signaling pathway
    102511209 (MAP2K2)
   04921 Oxytocin signaling pathway
    102511209 (MAP2K2)
   04926 Relaxin signaling pathway
    102511209 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    102511209 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    102511209 (MAP2K2)
   04916 Melanogenesis
    102511209 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102511209 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    102511209 (MAP2K2)
   04730 Long-term depression
    102511209 (MAP2K2)
   04722 Neurotrophin signaling pathway
    102511209 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102511209 (MAP2K2)
   05206 MicroRNAs in cancer
    102511209 (MAP2K2)
   05205 Proteoglycans in cancer
    102511209 (MAP2K2)
   05230 Central carbon metabolism in cancer
    102511209 (MAP2K2)
   05231 Choline metabolism in cancer
    102511209 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102511209 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102511209 (MAP2K2)
   05225 Hepatocellular carcinoma
    102511209 (MAP2K2)
   05226 Gastric cancer
    102511209 (MAP2K2)
   05214 Glioma
    102511209 (MAP2K2)
   05216 Thyroid cancer
    102511209 (MAP2K2)
   05221 Acute myeloid leukemia
    102511209 (MAP2K2)
   05220 Chronic myeloid leukemia
    102511209 (MAP2K2)
   05218 Melanoma
    102511209 (MAP2K2)
   05211 Renal cell carcinoma
    102511209 (MAP2K2)
   05219 Bladder cancer
    102511209 (MAP2K2)
   05215 Prostate cancer
    102511209 (MAP2K2)
   05213 Endometrial cancer
    102511209 (MAP2K2)
   05224 Breast cancer
    102511209 (MAP2K2)
   05223 Non-small cell lung cancer
    102511209 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102511209 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    102511209 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102511209 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102511209 (MAP2K2)
   05135 Yersinia infection
    102511209 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102511209 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    102511209 (MAP2K2)
   05161 Hepatitis B
    102511209 (MAP2K2)
   05160 Hepatitis C
    102511209 (MAP2K2)
   05164 Influenza A
    102511209 (MAP2K2)
   05163 Human cytomegalovirus infection
    102511209 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102511209 (MAP2K2)
   05165 Human papillomavirus infection
    102511209 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102511209 (MAP2K2)
   01522 Endocrine resistance
    102511209 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102511209 (MAP2K2)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     102511209 (MAP2K2)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: STE group
  STE7 family
   102511209 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 102511209
NCBI-ProteinID: XP_032321808
LinkDB
Position
22
AA seq 423 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGAEGEPHGISPRPRP
PGRPISGHGVDSRPAMAIFELLDYIVNEPPPKLPSVVFTQDFQEFVNKCSCRQAPWFPNP
ASPGPCSPQARLPSRLLGCPSPSTLWRPRSTSQVGWGLEGGPPRCPTCQDASTAGPGHSR
WTA
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctccagaagaag
ctggaggagctagaactcgacgagcaacagaagaagcggctggaagccttcctcacccag
aaggccaaggtcggagagctcaaggatgatgactttgaaaggatctcagagctgggagcc
gggaacggtggggtggtcaccaaggtccagcacagaccttcgggcctcatcatggcaaga
aagctgatccacctggagatcaagccggccatccggaaccagatcatccgcgagctgcag
gtgctgcacgagtgcaactccccgtacattgtgggcttctacggggccttctacagcgac
ggggagatcagcatctgcatggagcacatggatggtggctctctggaccaggtgttgaaa
gaagccaagagaattccggaagagatcctggggaaggtcagcatcgcggttctgcggggc
ctggcgtatctccgggaaaagcaccagatcatgcaccgagacgtgaagccatcgaacatc
ctcgtcaactccagaggggagatcaagctgtgcgattttggggttagcgggcagctcatc
gactccatggccaactccttcgtgggcacgcggtcctacatgtcgccagagcggctgcaa
ggcactcactactcggtgcagtcggacatctggagcatgggcctgtccctggtggagctg
tccatcggaaggtaccccatccccccgccagacgccaaggagctggaggcgatatttggc
cggcccatggtcgacggtgcagaaggagagcctcacggcatctcaccacggccgagaccc
cccggacgccccatcagcggtcatggggtggacagccggccggccatggctatcttcgag
ctgctggactacatcgtgaatgagcctcctcccaagctgcccagcgtcgttttcacccag
gacttccaggagtttgtaaataaatgctcctgccgtcaggcgccctggtttcctaatcct
gcaagcccagggccctgcagcccccaagcacgccttcccagccggcttctgggctgtccc
agcccctccaccctctggaggccgaggagtacctcgcaggtgggctggggcctggaggga
gggccgccccgctgccccacgtgtcaggacgccagcacggccggccccgggcacagccgc
tggacggcctag

KEGG   Camelus ferus (Wild Bactrian camel): 102515937
Entry
102515937         CDS       T02979                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04114  Oocyte meiosis
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04218  Cellular senescence
cfr04270  Vascular smooth muscle contraction
cfr04370  VEGF signaling pathway
cfr04371  Apelin signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04540  Gap junction
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04720  Long-term potentiation
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04726  Serotonergic synapse
cfr04730  Long-term depression
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04912  GnRH signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04916  Melanogenesis
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04926  Relaxin signaling pathway
cfr04928  Parathyroid hormone synthesis, secretion and action
cfr04929  GnRH secretion
cfr04934  Cushing syndrome
cfr04935  Growth hormone synthesis, secretion and action
cfr05010  Alzheimer disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05034  Alcoholism
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05216  Thyroid cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102515937 (MAP2K1)
   04012 ErbB signaling pathway
    102515937 (MAP2K1)
   04014 Ras signaling pathway
    102515937 (MAP2K1)
   04015 Rap1 signaling pathway
    102515937 (MAP2K1)
   04370 VEGF signaling pathway
    102515937 (MAP2K1)
   04371 Apelin signaling pathway
    102515937 (MAP2K1)
   04668 TNF signaling pathway
    102515937 (MAP2K1)
   04066 HIF-1 signaling pathway
    102515937 (MAP2K1)
   04068 FoxO signaling pathway
    102515937 (MAP2K1)
   04072 Phospholipase D signaling pathway
    102515937 (MAP2K1)
   04071 Sphingolipid signaling pathway
    102515937 (MAP2K1)
   04024 cAMP signaling pathway
    102515937 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    102515937 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    102515937 (MAP2K1)
   04150 mTOR signaling pathway
    102515937 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102515937 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102515937 (MAP2K1)
   04210 Apoptosis
    102515937 (MAP2K1)
   04218 Cellular senescence
    102515937 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102515937 (MAP2K1)
   04540 Gap junction
    102515937 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102515937 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102515937 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102515937 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    102515937 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    102515937 (MAP2K1)
   04660 T cell receptor signaling pathway
    102515937 (MAP2K1)
   04662 B cell receptor signaling pathway
    102515937 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    102515937 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    102515937 (MAP2K1)
   04062 Chemokine signaling pathway
    102515937 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102515937 (MAP2K1)
   04929 GnRH secretion
    102515937 (MAP2K1)
   04912 GnRH signaling pathway
    102515937 (MAP2K1)
   04915 Estrogen signaling pathway
    102515937 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    102515937 (MAP2K1)
   04917 Prolactin signaling pathway
    102515937 (MAP2K1)
   04921 Oxytocin signaling pathway
    102515937 (MAP2K1)
   04926 Relaxin signaling pathway
    102515937 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    102515937 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    102515937 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    102515937 (MAP2K1)
   04916 Melanogenesis
    102515937 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102515937 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    102515937 (MAP2K1)
   04726 Serotonergic synapse
    102515937 (MAP2K1)
   04720 Long-term potentiation
    102515937 (MAP2K1)
   04730 Long-term depression
    102515937 (MAP2K1)
   04722 Neurotrophin signaling pathway
    102515937 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102515937 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102515937 (MAP2K1)
   05206 MicroRNAs in cancer
    102515937 (MAP2K1)
   05205 Proteoglycans in cancer
    102515937 (MAP2K1)
   05230 Central carbon metabolism in cancer
    102515937 (MAP2K1)
   05231 Choline metabolism in cancer
    102515937 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102515937 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102515937 (MAP2K1)
   05212 Pancreatic cancer
    102515937 (MAP2K1)
   05225 Hepatocellular carcinoma
    102515937 (MAP2K1)
   05226 Gastric cancer
    102515937 (MAP2K1)
   05214 Glioma
    102515937 (MAP2K1)
   05216 Thyroid cancer
    102515937 (MAP2K1)
   05221 Acute myeloid leukemia
    102515937 (MAP2K1)
   05220 Chronic myeloid leukemia
    102515937 (MAP2K1)
   05218 Melanoma
    102515937 (MAP2K1)
   05211 Renal cell carcinoma
    102515937 (MAP2K1)
   05219 Bladder cancer
    102515937 (MAP2K1)
   05215 Prostate cancer
    102515937 (MAP2K1)
   05213 Endometrial cancer
    102515937 (MAP2K1)
   05224 Breast cancer
    102515937 (MAP2K1)
   05223 Non-small cell lung cancer
    102515937 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102515937 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    102515937 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    102515937 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102515937 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102515937 (MAP2K1)
   05135 Yersinia infection
    102515937 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102515937 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    102515937 (MAP2K1)
   05161 Hepatitis B
    102515937 (MAP2K1)
   05160 Hepatitis C
    102515937 (MAP2K1)
   05164 Influenza A
    102515937 (MAP2K1)
   05163 Human cytomegalovirus infection
    102515937 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102515937 (MAP2K1)
   05165 Human papillomavirus infection
    102515937 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102515937 (MAP2K1)
   01522 Endocrine resistance
    102515937 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102515937 (MAP2K1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     102515937 (MAP2K1)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: STE group
  STE7 family
   102515937 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 102515937
NCBI-ProteinID: XP_032336797
LinkDB
Position
6
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETLPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaaaaagaagccgacgcccatccagctgaacccggctcccgacggctccgcggtt
aacgggaccagctcggcagagaccaatctggaggccttgcagaagaagctggaggagctg
gagctggatgaacagcagcggaagcgcctcgaggcctttcttacccagaagcagaaggtg
ggggaactgaaggatgacgactttgagaagatcagtgagctgggtgccggcaatggtggt
gtggtgttcaaggtctcccacaagccatccggcctcgtcatggccagaaagctaattcac
ctggagatcaagcctgcaatccggaaccagatcataagggagcttcaggttctgcatgag
tgcaactccccgtacatcgtgggcttttatggtgcgttctacagcgacggcgagatcagc
atctgcatggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacgtacctg
agagagaagcacaagattatgcacagagatgtcaaaccttccaacatcctagtgaactcc
cgtggggagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggcc
aactccttcgtgggcacgaggtcctacatgtcgccagaaaggctccaggggactcattac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcggttgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaggtggag
ggagacgcggctgagaccctgcccaggccacggacccccgggaggcccctcagctcttat
ggaatggacagccggcctcccatggcaatcttcgagttgttggattacatagtcaatgag
cctccaccaaaactgcccagtggagtgttcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccccgccgagagagcagatttgaagcaactcatggttcacgctttc
atcaagagatctgatgctgaggaagtggattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacgcccacccacgcagctggcgtctaa

DBGET integrated database retrieval system