Camelus ferus (Wild Bactrian camel): 102522300 Help Entry 102522300         CDS       T02979                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr01522   Endocrine resistance cfr04110   Cell cycle cfr04115   p53 signaling pathway cfr04151   PI3K-Akt signaling pathway cfr04218   Cellular senescence cfr04530   Tight junction cfr04660   T cell receptor signaling pathway cfr04933   AGE-RAGE signaling pathway in diabetic complications cfr04934   Cushing syndrome cfr05160   Hepatitis C cfr05162   Measles cfr05163   Human cytomegalovirus infection cfr05164   Influenza A cfr05165   Human papillomavirus infection cfr05166   Human T-cell leukemia virus 1 infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05169   Epstein-Barr virus infection cfr05200   Pathways in cancer cfr05203   Viral carcinogenesis cfr05212   Pancreatic cancer cfr05214   Glioma cfr05218   Melanoma cfr05219   Bladder cancer cfr05220   Chronic myeloid leukemia cfr05222   Small cell lung cancer cfr05223   Non-small cell lung cancer cfr05224   Breast cancer cfr05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     102522300 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102522300 (CDK4)    04115 p53 signaling pathway     102522300 (CDK4)    04218 Cellular senescence     102522300 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     102522300 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     102522300 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102522300 (CDK4)    05203 Viral carcinogenesis     102522300 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     102522300 (CDK4)    05225 Hepatocellular carcinoma     102522300 (CDK4)    05214 Glioma     102522300 (CDK4)    05220 Chronic myeloid leukemia     102522300 (CDK4)    05218 Melanoma     102522300 (CDK4)    05219 Bladder cancer     102522300 (CDK4)    05224 Breast cancer     102522300 (CDK4)    05222 Small cell lung cancer     102522300 (CDK4)    05223 Non-small cell lung cancer     102522300 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102522300 (CDK4)    05160 Hepatitis C     102522300 (CDK4)    05164 Influenza A     102522300 (CDK4)    05162 Measles     102522300 (CDK4)    05163 Human cytomegalovirus infection     102522300 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     102522300 (CDK4)    05169 Epstein-Barr virus infection     102522300 (CDK4)    05165 Human papillomavirus infection     102522300 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102522300 (CDK4)    04934 Cushing syndrome     102522300 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102522300 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:cfr01001]     102522300 (CDK4) Enzymes [BR:cfr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      102522300 (CDK4) Protein kinases [BR:cfr01001]  Serine/threonine kinases: CMGC group   CDK family    102522300 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  102522300 NCBI-ProteinID:  XP_006182588 UniProt:  A0A8B8U459 LinkDB All DBs Position 12:complement(23203496..23206380) Genome browser AA seq 303 aa AA seqDB search MTTPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGSGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atgactacccctcgatatgagccagtggctgagattggtgttggtgcctatgggacggtg tacaaagcccgtgatccccacagtggccactttgtggccctcaagagcgttagagttccc aatggaggaggctctggagggggcctgcccatcagcacagttcgtgaggtggccttactg cggcgcctggaggcttttgagcatcccaatgttgtacggctgatggacgtctgtgccaca gcccgaactgaccgggaaaccaaagtgaccctggtatttgagcatgtggaccaagaccta aggacatatctggacaaggcacccccaccaggcttgccagtggagaccatcaaggatctg atgcgccagttcctaagaggcctagatttccttcatgccaactgcattgttcaccgagac ctgaagccagagaacattctggtgacgagtggtgggacagtcaagctggctgactttggc ctggccaggatctacagctaccagatggcacttacacctgtggtggttacactctggtac cgtgctccggaagttcttctgcagtctacgtatgcaacacctgtggacatgtggagcgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctgttctgtggaaactctgaagct gaccagttaggcaaaatctttgacctgattgggctgcccccagaggatgactggccccga gatgtgtctctgccccgaggagccttttcccccagaggaccgcgcccagtgcagtcagtg gttcctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacataaggcagaaggt aacccagagtga

DBGET integrated database retrieval system