KEGG   Camelus ferus (Wild Bactrian camel): 102523769
Entry
102523769         CDS       T02979                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04020  Calcium signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04510  Focal adhesion
cfr04540  Gap junction
cfr04630  JAK-STAT signaling pathway
cfr04810  Regulation of actin cytoskeleton
cfr05160  Hepatitis C
cfr05165  Human papillomavirus infection
cfr05200  Pathways in cancer
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05226  Gastric cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102523769 (EGF)
   04012 ErbB signaling pathway
    102523769 (EGF)
   04014 Ras signaling pathway
    102523769 (EGF)
   04015 Rap1 signaling pathway
    102523769 (EGF)
   04630 JAK-STAT signaling pathway
    102523769 (EGF)
   04066 HIF-1 signaling pathway
    102523769 (EGF)
   04068 FoxO signaling pathway
    102523769 (EGF)
   04020 Calcium signaling pathway
    102523769 (EGF)
   04072 Phospholipase D signaling pathway
    102523769 (EGF)
   04151 PI3K-Akt signaling pathway
    102523769 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102523769 (EGF)
   04540 Gap junction
    102523769 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102523769 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102523769 (EGF)
   05231 Choline metabolism in cancer
    102523769 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102523769 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102523769 (EGF)
   05212 Pancreatic cancer
    102523769 (EGF)
   05226 Gastric cancer
    102523769 (EGF)
   05214 Glioma
    102523769 (EGF)
   05218 Melanoma
    102523769 (EGF)
   05219 Bladder cancer
    102523769 (EGF)
   05215 Prostate cancer
    102523769 (EGF)
   05213 Endometrial cancer
    102523769 (EGF)
   05224 Breast cancer
    102523769 (EGF)
   05223 Non-small cell lung cancer
    102523769 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102523769 (EGF)
   05165 Human papillomavirus infection
    102523769 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102523769 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102523769 (EGF)
Cytokines and growth factors [BR:cfr04052]
 Growth factors
  Growth factors (RTK binding)
   102523769 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3 Tr-sialidase_C MMPL
Other DBs
NCBI-GeneID: 102523769
NCBI-ProteinID: XP_032317698
LinkDB
Position
2
AA seq 1173 aa
MLLFLIILLPVVFKFSFVSPLALQRWNCPEGFPSGDGNSDRVGPAPFLIFSHGSSVFRID
LEGTNHKQLVADAGISVIMDFHYNEERIYWVDLERQLLQRVLLNGTRQEKVCHIEKNVSG
LAINWINEELIWSNQQEGIITVTDMKGNNSRVLLSALKYPANVAVDPVERFMFWSSEVAG
SLHRADLSGVEVKLLLETSEKIAAVSLDVLDKRLFWIQNNREGSDSRIWSCDYDGGSVHF
SKHLTQHNLFAMSLFGDRIFYSSWKKKAIWIANKHTGKDMVKINLNLSFVPPGGIKVVHP
LVQPQARSAASASDQELCKLQKGNCRGSMCGQEPKSRLCTCAEGYALSQDGKNCEDVNEC
AFWNHGCTLGCENIPGSYHCTCPVGFVLLSDGKRCHQLISCPNNVSECSHDCVLTSDGPI
CFCPEGSVLETDGKTCTGCSSPDNGGCSQLCIPLSPVSWECGCFPGYDLQLDKKSCTASG
PEPFLLFANSQDIRHMCFDGTDYGTLLSQQMGTVFALDYDPVENKVYFAHTALKWIERAN
MDGSQRERLIEEAIDTPEGLAVDWIGRKFYWTDRRKSLIQGSNLNGKYREVIIKEDISQP
RGIAVHPMAKRLFWTDMGINPRIESSSLQGIGRLIIVNSDLIWPSGITIDYLTDKLYWCD
AKQSVIEMANLDGSERQRLAQNDVGHPFAVAVFEDHVWFSDWTMPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGADPCLHQNGGCEHICKERFGIAQCLCREGFVKAPDGKAC
LALNGHQILAGSGPDLSNQVTPLDILPRSREFEDNSTGSQQMLVAEIMVSDDDDCGAMGC
SPQAQCVSEGEDATCQCLKGFAGDGRLCSDIDECEMGISVCPPRSSTCINTEGGHVCRCS
EGYQGDGIHCLDSTPVSYLREDGPYSVRSVYRKCPPSYHGYCLNGGVCTYLELINHSACT
CVVGFFGERCQSQDFTWWDLRHADHGQQQSITVVAVCVVALVLLLLLGLWGAHYYRTQKL
LSKTPKNPYEESSRGVSGIGPADGETGMSSCPQPWFVVIKEHQNLRNGSQPLALEDGLVA
DVGQFSSLEPGPLQSPPWRKEPQMYMGAEQGCCIPSSGDKGSGLQGMKCSFHLPSCGVRP
IAVGLEKSHSLLSANPLRQQRAPDPPHQMEVTQ
NT seq 3522 nt   +upstreamnt  +downstreamnt
atgctgcttttccttatcattctgttgccagtagtttttaagtttagttttgttagcccc
ttagcactgcagcgctggaactgtcctgaaggctttccctcaggagatgggaattctgat
cgtgtgggtcctgcgccctttttaattttctctcatggaagcagtgtctttcggattgac
ttggaaggaacaaatcataagcaattagtggcagatgctggcatatcagtgatcatggat
tttcattacaatgaagaaagaatctattgggtcgatctagaaagacaacttttgcaaaga
gttttgctgaatgggacaaggcaagagaaagtatgccatatagagaaaaatgtttcagga
ctggcaataaattggatcaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaacaattcccgtgttctcttaagcgccttaaaatatcct
gcaaatgtagcagttgatccagtagaaaggtttatgttttggtcctcagaggtggctggc
agccttcacagagcagacctcagcggtgtggaagtgaagcttctgttagagacgtcagag
aaaattgcagctgtgtcattggatgtgcttgataaacggctcttttggattcagaacaat
agagaaggaagtgattctcgtatttggtcctgtgattatgatgggggttctgtacatttt
agcaaacatctcacacagcacaatttgtttgcaatgtccctttttggtgatcgtatcttc
tattcatcatggaaaaagaaggcaatttggatagctaacaagcacactggcaaggatatg
gttaaaattaacctcaatctatcatttgtaccacctggtggaattaaagtagtgcatcca
ctcgtccagccccaggcaagaagtgctgcttcggcctctgatcaggaactctgcaaactg
cagaaaggaaactgtagaggcagcatgtgtgggcaagagcctaagtcccgtttgtgcacg
tgtgcagagggatacgctttaagtcaagatggaaagaactgtgaagatgtcaacgagtgt
gccttttggaatcacggctgtactcttggatgtgaaaacatccctggatcctatcactgt
acatgccctgtaggatttgttctgctttctgatgggaaacggtgtcaccaactaatttcc
tgcccaaacaatgtatctgaatgcagccatgactgtgttctgacatcagatggtcccata
tgtttctgtcctgaaggctcagtgcttgagacagatggaaaaacatgtactggctgttca
tcacctgataatggtggatgtagccagctctgcatccctctcagcccagtatcctgggag
tgtggttgctttcctggatatgacctacagctggacaaaaagagctgtacagcgtcagga
ccagagccttttttgctttttgccaattctcaagatattcgacacatgtgtttcgatgga
acagattatggaaccctgctcagccagcaaatgggaacggtttttgccctagattatgac
cctgtggaaaataaggtgtactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaagaagcaatagatacgccagaaggtctt
gctgttgactggattggccgtaaattctattggacagacagaaggaaatctctcattcaa
gggagtaatttaaatggaaaataccgtgaagtaatcattaaagaggatatctctcagcca
cgaggaattgctgttcatccaatggccaagagattattctggactgatatggggattaat
ccacgaattgaaagttcttcccttcaaggcattggccgactgattatagttaactcagat
ctgatctggcccagtggaataacgattgattacctaactgacaagttgtactggtgtgat
gccaagcagtctgtgattgaaatggccaatctagatggttcagaacgccaaagacttgcc
cagaacgatgtaggtcacccatttgctgtggctgtgtttgaggatcatgtgtggttctcc
gattggactatgccatcggtaataagggtgaacaagaggactggcaaaaacagggtacgt
ctccgaggcagcatgctgaagccctcatcactggttgtagttcatccattggcaaaacca
ggagcagatccctgtttgcatcaaaatggaggctgtgaacatatttgcaaagagaggttt
ggaattgctcagtgtttgtgtcgtgaaggttttgtgaaagccccggatggaaaagcatgt
ctggctctgaatggccatcagatattggcaggtagtggaccagatctgagtaatcaagta
acgccattggacatcttacccaggagtagggagtttgaagataacagtacaggatctcaa
cagatgctagtggctgaaatcatggtgtcagatgacgatgactgtggtgccatgggatgc
agtccacaggctcagtgtgtttcagagggagaggatgccacgtgtcagtgtttgaaagga
tttgctggagatggaagactatgttctgatatagatgaatgtgagatgggtatctcagtt
tgccctccccgctcctccacgtgcatcaatactgaaggtggccacgtctgccgatgctca
gaaggctaccaaggagatgggattcactgtcttgactctactccggtgtcttacctcagg
gaggatggcccctattctgtgagaagtgtgtaccgcaaatgtccgccatcctatcatggg
tactgtctcaacggtggtgtgtgtacttatcttgaactaatcaaccactctgcctgcacc
tgtgttgttggcttcttcggggagcgatgtcagtctcaagactttacatggtgggatctg
cgccacgctgaccacgggcagcagcagagcatcaccgtggtggctgtctgtgtggtggca
ctggtcctgctgctgctcctggggctgtggggggctcactactacaggactcagaagctg
ctatcgaaaactccaaagaatccttatgaagagtccagcagaggtgtgagtggtatcggg
cctgctgatggcgagactgggatgtcctcttgtccccaaccttggtttgtggttataaag
gaacatcaaaacctcaggaatggaagtcaacctctagccctcgaggatggcctggtagca
gatgttggccagttttcttctctggagcctgggccactgcagtcaccaccgtggaggaag
gagccccagatgtatatgggcgcagaacaaggatgctgcatcccttcatctggtgacaaa
ggctctggtctccaggggatgaagtgtagctttcatctaccctcctgtggggtacgaccc
attgctgtggggcttgagaagtcccattctctcctgtcagctaacccattaaggcagcaa
agagccccagatccaccacaccaaatggaggtgactcagtga

DBGET integrated database retrieval system