KEGG   Camelus ferus (Wild Bactrian camel): 102524019
Entry
102524019         CDS       T02979                                 

Gene name
RBL2
Definition
(RefSeq) retinoblastoma-like protein 2
  KO
K16332  retinoblastoma-like protein 2
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04151  PI3K-Akt signaling pathway
cfr04218  Cellular senescence
cfr05165  Human papillomavirus infection
cfr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102524019 (RBL2)
   04151 PI3K-Akt signaling pathway
    102524019 (RBL2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102524019 (RBL2)
   04218 Cellular senescence
    102524019 (RBL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102524019 (RBL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102524019 (RBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102524019 (RBL2)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    102524019 (RBL2)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB SLH
Other DBs
NCBI-GeneID: 102524019
NCBI-ProteinID: XP_032342214
LinkDB
Position
9
AA seq 1141 aa
MPSGGDQSPPPPPPPPAAAAASDEEEEDDGEAEDAAQPARSPAPQTQQRFDELCSRLNMD
EAARAEAWDSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILR
CSEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQE
EQPRQQRGRKQRRQPCTVSEVFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGN
ALQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCVIEKLCSLHDGLVLEAKGIKEHFWK
PYIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGEDAE
EEIGTLSRCLNTGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYIKDNSPCVTPV
STATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRNPTQAIANRLKEMYEIYTQHSQPDED
FSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEV
VAFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAW
KPESPLWDRIRDNENRVPTCEEVMPPQNLERADEMCTAGSPLTPRRVSEVRADTGGLGRS
IASPTTLYDRYSSPTASSTRRRLFVENDSPTDGGTPGRIPPQPLVNAVSVQNVSGEAVSV
TPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQP
LSAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKPGLPLTSGSIRPRKTSSLSLF
FRKVYHLAGVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVM
AKVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKD
RTSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDVEEEERGDLIQFYNNIYIKQIKT
FAMKYSQANVMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFS
NSPSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGS
H
NT seq 3426 nt   +upstreamnt  +downstreamnt
atgccgtcgggaggcgaccagtcgccgccgcccccgcctccccctccggcggcggcggcg
gcctcggacgaggaggaggaagacgacggcgaggcggaggatgccgcgcagccggcccgg
tcgccggcccctcaaacccagcagcggttcgacgagctgtgcagccgcctgaacatggac
gaggcggcgcgggccgaggcctgggacagctaccggagcatgagcgagagctacacgctg
gagggaaatgatcttcattggttagcatgtgccttatatgtggcttgcagaaaatctgtg
ccaactgtaagcaaaggaacagttgaaggaaactatgtatctttaactagaatcctgaga
tgttcagagcagagcttaattgaattttttaacaagatgaagaagtgggaagacatggca
aatctacccccacatttcagagaacgtactgagagattagagagaaacttcactgtttct
gctgtaatttttaagaaatatgaacccatttttcaggacatttttaagtatcctcaagag
gaacagccccggcaacaaagaggaagaaaacagcggcgacagccctgtaccgtgtctgaa
gttttccatttttgttgggtgctttttatatatgcaaaaggtaatttccccatgattagt
gatgatttagttaattcttatcatcttctgctgtgtgctttggacttagtttatggaaat
gcccttcagtgttccaatcgtaaagaacttgtgaaccctaattttaaaggcctatctgaa
gattttcatgctaaggattctaaaccttcctctgacccaccttgtgtcattgagaaactc
tgttccttacatgatggcctagttttggaagcaaagggaataaaggaacatttctggaaa
ccctatattaggaaactttatgaaaaaaagctccttaagggaaaagaagaaaatcttact
ggttttttagaacctgggaatttcggggagagttttaaagccatcaataaggcctatgag
gagtatgttttatctgttggaaacttagatgaacggatttttcttggagaggatgctgaa
gaggaaattgggactctctcaaggtgtctgaacactggttcaggaacagagactgctgaa
agggtgcagatgaaaaacatcttgcagcagcactttgacaagtctaaagcacttagaatc
tccacaccacttactggtgtgaggtacattaaggacaacagcccttgtgtgactccagtt
tctacagcgactcatagcttgagtcgtcttcacaccatgctaacaggcctcaggaatgca
ccaagtgagaaactggaacagattctaaggacatgttccagaaatccaacccaagctatt
gccaacagattgaaagaaatgtatgaaatatatactcaacattcccagccagatgaggat
ttcagtaattgtgctaaagaaattgccagcaaacattttcgttttgcagagatgctttat
tataaagtattagaatctgttattgagcaggagcaaaaaaggctgggagacatggattta
tctggcattctggaacaagatgcattccacagatcacttttggcgtgctgtcttgaggtc
gtcgctttttcttataagcctcctgggaattttccatttattactgaaatatttgatgtg
ccactttatcatttttataaggtgatagaagtattcattagagcagaagatggtctttgt
agagaggtggtaaaacatcttaatcaaattgaagaacagatcttggatcatttggcatgg
aaaccagagtctccactgtgggacagaattagagacaatgaaaacagagttcctacatgc
gaagaggtcatgccccctcagaacctggaaagagcagatgaaatgtgtactgctggctcc
cctttgactcccagaagggtgagtgaagttcgtgctgatactggaggacttggaagaagc
atagcatctccaaccacattatacgataggtacagctccccgacagccagctctaccagg
aggaggctgtttgttgagaatgatagccccactgatggagggacacctgggcgcattccc
ccacagcctctggtcaatgccgtctctgtgcagaatgtatctggggaggctgtttctgtc
acaccagttcctggacagactttggtcaccatggcaacagccactgtcacagccaacaat
ggacaaacagtgaccattcctgtgcaaggcattgccaatgaaaatggaggaataacattc
ttcccagtccaagtcaatgttggggggcaggcacaagctgtgactggctccatccagccc
ctcagtgctcaggccctggctggaagtttgagctctcaacaggtgacaggaacgaccttg
caagtccctggtcaggtggccattcaacagatttccccaggtggacagcagcagaaacca
ggcctgcctttaaccagcggcagtattagacccaggaagaccagttctttatcacttttc
tttagaaaggtttaccacttagcaggtgttcgccttcgggatctttgtgctaaactggat
atttcagatgaactgaggaaaaaaatctggacttgttttgaattctccataattcagtgt
cctgaacttatgatggacagacatctggaccagttgttaatgtgtgccatttatgtgatg
gcaaaggtcacaaaagaagacaagtccttccagaatattatgcgttgttataggactcag
ccacaggcccggagccaggtgtatagaagtgttttgataaaagggaaaaggaaaagaaga
aattctggcagcagtgatagcagaagccatcagaattctccaacagaactaaacaaagac
agaaccagcagagactccagccctgtcatgaggtcgagcagcaccctgccggttccacag
ccgagcagtgcccctccgacaccgactcgcctcacaggtgccaacagcgacgtggaagag
gaggagaggggagacctcattcagttctacaacaacatctacataaagcagattaaaaca
tttgccatgaagtattcacaggcaaatgtaatggatgctcctccactctccccttaccca
tttgtaagaacaggctctcctcgccgaatacagttgtctcaaaatcatcctgtctacatt
tccccacataaaaatgaaacaatgctttctcctcgagaaaagattttctactacttcagc
aacagtccttcaaagagactgagagaaattaacagtatgatacggacaggagaaactcca
accaaaaagagagggattcttttggaagatggaagtgaatcacctgcaaaaagaatttgc
ccagaaaatcattctgccttattacgccgtctccaagatgtagctaatgaccgaggttcc
cactga

DBGET integrated database retrieval system