KEGG   Cricetulus griseus (Chinese hamster): 100769627
Entry
100769627         CDS       T02813                                 

Gene name
Grb2
Definition
(RefSeq) growth factor receptor-bound protein 2 isoform X1
  KO
K04364  growth factor receptor-bound protein 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04072  Phospholipase D signaling pathway
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04630  JAK-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04722  Neurotrophin signaling pathway
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04926  Relaxin signaling pathway
cge04935  Growth hormone synthesis, secretion and action
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100769627 (Grb2)
   04012 ErbB signaling pathway
    100769627 (Grb2)
   04014 Ras signaling pathway
    100769627 (Grb2)
   04630 JAK-STAT signaling pathway
    100769627 (Grb2)
   04068 FoxO signaling pathway
    100769627 (Grb2)
   04072 Phospholipase D signaling pathway
    100769627 (Grb2)
   04151 PI3K-Akt signaling pathway
    100769627 (Grb2)
   04150 mTOR signaling pathway
    100769627 (Grb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100769627 (Grb2)
   04540 Gap junction
    100769627 (Grb2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100769627 (Grb2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100769627 (Grb2)
   04660 T cell receptor signaling pathway
    100769627 (Grb2)
   04662 B cell receptor signaling pathway
    100769627 (Grb2)
   04664 Fc epsilon RI signaling pathway
    100769627 (Grb2)
   04062 Chemokine signaling pathway
    100769627 (Grb2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100769627 (Grb2)
   04912 GnRH signaling pathway
    100769627 (Grb2)
   04915 Estrogen signaling pathway
    100769627 (Grb2)
   04917 Prolactin signaling pathway
    100769627 (Grb2)
   04926 Relaxin signaling pathway
    100769627 (Grb2)
   04935 Growth hormone synthesis, secretion and action
    100769627 (Grb2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100769627 (Grb2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100769627 (Grb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100769627 (Grb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100769627 (Grb2)
   05206 MicroRNAs in cancer
    100769627 (Grb2)
   05205 Proteoglycans in cancer
    100769627 (Grb2)
   05203 Viral carcinogenesis
    100769627 (Grb2)
   05231 Choline metabolism in cancer
    100769627 (Grb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100769627 (Grb2)
   05225 Hepatocellular carcinoma
    100769627 (Grb2)
   05226 Gastric cancer
    100769627 (Grb2)
   05214 Glioma
    100769627 (Grb2)
   05221 Acute myeloid leukemia
    100769627 (Grb2)
   05220 Chronic myeloid leukemia
    100769627 (Grb2)
   05211 Renal cell carcinoma
    100769627 (Grb2)
   05215 Prostate cancer
    100769627 (Grb2)
   05213 Endometrial cancer
    100769627 (Grb2)
   05224 Breast cancer
    100769627 (Grb2)
   05223 Non-small cell lung cancer
    100769627 (Grb2)
  09165 Substance dependence
   05034 Alcoholism
    100769627 (Grb2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100769627 (Grb2)
   05160 Hepatitis C
    100769627 (Grb2)
   05163 Human cytomegalovirus infection
    100769627 (Grb2)
   05165 Human papillomavirus infection
    100769627 (Grb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100769627 (Grb2)
   01522 Endocrine resistance
    100769627 (Grb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100769627 (Grb2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cge04990]
    100769627 (Grb2)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    100769627 (Grb2)
Domain-containing proteins not elsewhere classified [BR:cge04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100769627 (Grb2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH2 SH3_2 SH3_10 SH2_2 DUF5093 SH3_4
Other DBs
NCBI-GeneID: 100769627
NCBI-ProteinID: XP_027281483
UniProt: G3GTE4
LinkDB
Position
7
AA seq 244 aa
MEAIAKYDFKATADDELSFKRGDILKEDCPPTGEHNPVCLDDFITGARPTFLCVLNEECD
QNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPG
DFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ
VPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPV
NRNV
NT seq 735 nt   +upstreamnt  +downstreamnt
atggaagccatcgccaaatatgacttcaaagctactgctgacgatgagctgagcttcaaa
aggggggacatccttaaggaagactgccctcccactggtgagcacaacccagtctgcttg
gatgatttcatcacaggtgcaaggcctacatttttgtgtgttttgaatgaagagtgtgat
cagaactggtataaggcagagctcaatgggaaggatggcttcattcccaagaactacata
gaaatgaaaccacatccgtggttttttggcaaaatccccagagccaaggcagaagaaatg
cttagcaaacagaggcatgatggggccttcctaatccgagagagcgagagtgcccctggg
gacttctccctgtctgtcaagtttggaaatgatgtccagcacttcaaggtgctccgagac
ggggccgggaagtacttcctgtgggtggtgaaatttaactctttgaatgaactggtggac
taccacagatccacgtcagtgtccaggaaccagcagatattcctgcgggacatagagcag
gtgccacagcagccaacgtatgtccaggcactgtttgactttgacccccaggaagacggt
gagctgggctttcgcagaggagacttcatccatgtcatggataactcagatcccaactgg
tggaagggggcctgccatgggcagaccggcatgtttccccgcaattacgtcaccccagtg
aaccggaacgtctaa

DBGET integrated database retrieval system