KEGG   Capra hircus (goat): 100860747
Entry
100860747         CDS       T02910                                 

Gene name
TLR2, TLR-2
Definition
(RefSeq) toll like receptor 2
  KO
K10159  toll-like receptor 2
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04151  PI3K-Akt signaling pathway
chx04620  Toll-like receptor signaling pathway
chx05132  Salmonella infection
chx05134  Legionellosis
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05144  Malaria
chx05145  Toxoplasmosis
chx05146  Amoebiasis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05162  Measles
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05205  Proteoglycans in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05321  Inflammatory bowel disease
chx05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100860747 (TLR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100860747 (TLR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100860747 (TLR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100860747 (TLR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100860747 (TLR2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100860747 (TLR2)
   05321 Inflammatory bowel disease
    100860747 (TLR2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100860747 (TLR2)
   05134 Legionellosis
    100860747 (TLR2)
   05152 Tuberculosis
    100860747 (TLR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100860747 (TLR2)
   05161 Hepatitis B
    100860747 (TLR2)
   05171 Coronavirus disease - COVID-19
    100860747 (TLR2)
   05162 Measles
    100860747 (TLR2)
   05168 Herpes simplex virus 1 infection
    100860747 (TLR2)
   05169 Epstein-Barr virus infection
    100860747 (TLR2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100860747 (TLR2)
   05144 Malaria
    100860747 (TLR2)
   05145 Toxoplasmosis
    100860747 (TLR2)
   05140 Leishmaniasis
    100860747 (TLR2)
   05142 Chagas disease
    100860747 (TLR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    100860747 (TLR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    100860747 (TLR2)
   04054 Pattern recognition receptors [BR:chx04054]
    100860747 (TLR2)
   04090 CD molecules [BR:chx04090]
    100860747 (TLR2)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    100860747 (TLR2)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    100860747 (TLR2)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100860747 (TLR2)
Pattern recognition receptors [BR:chx04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100860747 (TLR2)
CD molecules [BR:chx04090]
 Proteins
  100860747 (TLR2)
Glycosaminoglycan binding proteins [BR:chx00536]
 Hyaluronan
  Cell surface receptors
   100860747 (TLR2)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRRCT LRR_1
Other DBs
NCBI-GeneID: 100860747
NCBI-ProteinID: NP_001272532
UniProt: Q0GC71
LinkDB
Position
17
AA seq 784 aa
MPRALWTAWVWAVIILSMEGASHQASSLSCDPTGVCDGHSRSLNSIPSGLTDGVKSLDLS
NNEITYVSNRDLQRCVNLKTLRLGANEIHTVEEDSFFHLRNLEYLDLSYNRLSNLSSSWF
RSLYALKFLNLLGNVYKTLGETSLFSHLPNLRTLKVGNSNSFTEIHEKDFTGLIFLEELE
ISAQNLQIYVPKSLKSIQNISHLILHLKQPVLLVDILVDIVSSLDCLELRDTNLHTFHFS
EASISEMNTSVKKLIFRNVQFTDESFVEVVKLFNYVSGILEVEFDDCTHDGIGDFRALSL
DRIRHLGNVETLTIRKLHIPQFFLFHDLSSIYPLTGKVKRVTIESSKVFLVPCLLSQHLK
SLEYLDLSENLMSEETLKNSACKDAWPFLQTLVLRQNRLKSLEKTGELLLTLKNLNNLDI
SKNNFLSMPETCQWPGKMKQLNLSSTRIHSLTQCLPQTLEILDVSNNNLDSFSLILPQLK
ELYISRNKLKTLPDASFLPVLSVMRISGNIINTFSKEQLDSFPQLKALEAGGNNFICSCD
FLSFTQGQQALARVLVDWPDGYRCDAPSHVRGQRVQDARLSLSECHRAAVVSAVCCALFL
LLLLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPRRDLCYDAFVSYSEQDSYWVENLMV
QELEHFNPPFKLCLHKRDFVPGKWIIDNIIDSIEKSRKTIFVLSENFVRSEWCKYELDFS
HFRLFDENNDAAILILLEPIDKKAIPQRFCKLRKIMNTKTYLEWPTDETQQEAFWLNLRA
AIRS
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgccacgtgctttgtggacagcgtgggtctgggctgtaatcatcctgtccatggaagga
gcctctcatcaggcttcttctctgtcttgtgacccaactggtgtctgtgatggccattcc
agatctttaaactccatcccctctggtctcacagacggtgtgaaaagccttgacctgtcc
aacaacgagatcacctatgtcagcaacagagacctgcagaggtgtgtgaacctgaagact
ctgaggctgggggccaatgaaattcacacagtggaggaagattctttttttcacctgagg
aatcttgaatatttggatttatcctataatcgcttatctaacttatcatcctcctggttc
aggtccctttatgccttgaaattcttaaacttactgggaaatgtatacaaaacacttggg
gaaacatctcttttttctcatctcccaaatctgcggaccctgaaagtaggaaatagtaac
agcttcactgagattcatgaaaaggatttcactggactcatttttcttgaggagcttgag
atcagtgctcaaaatctgcagatatatgtgccaaagagtttaaagtcaatccagaacatt
agccatctgattctacatctgaagcagcctgttttactcgtggacattcttgtagatatt
gtaagttccttagattgtttagaactgagagatactaatttgcacactttccatttttca
gaagcatccatcagtgaaatgaatacatctgttaaaaagcttatatttagaaatgtgcaa
ttcaccgatgaaagttttgtcgaagttgtcaaactgtttaactatgtttctgggatctta
gaagtagagtttgatgactgtacccatgatggaattggcgattttagagcactgagtttg
gacagaattagacacctaggtaacgtggagacgttaacaatacggaagttgcatattcca
cagtttttcttatttcatgatctcagtagtatatatccactcacaggcaaagttaaaaga
gtcacaatagaaagcagtaaggtttttctggttccttgtttactttcacaacatttaaaa
tcattagaatatttggatctcagtgaaaacttaatgtctgaagaaaccttgaaaaactca
gcctgtaaggatgcctggcccttccttcaaaccttggttttaaggcagaatcgtttgaaa
tcactagaaaaaacgggagaacttttgcttactctgaaaaatctgaataaccttgatatc
agtaagaataattttctttcaatgcctgaaacttgtcagtggccaggaaaaatgaaacag
ttgaacttatccagcacgaggatacacagtttaacccagtgccttccccagaccctggaa
attttagatgttagcaataacaatctcgattcattttctttgattttgccgcaactcaaa
gaactttatatttccagaaataagttgaagactctaccagatgcctccttcttacccgtg
ttatcagttatgagaattagcggaaatataataaatactttctcgaaggaacaacttgat
tcttttccacaactgaaggctttggaggccggtggcaacaacttcatttgctcctgtgac
ttcctgtccttcacacagggacagcaggcactggcccgtgtcctggtcgactggccagat
ggctaccgctgtgacgctccctcgcacgtgcggggccagcgggtgcaggacgcccggctc
tccctttctgaatgccaccgggcggccgtggtgtccgccgtgtgctgtgccctcttcctg
ttgctcctgctcacgggggtgctgtgtcaccgtttccacgggctgtggtacatgaagatg
atgtgggcctggctccaggccaagaggaagcccaggaaggctccccgcagggacctctgc
tacgacgcctttgtgtcctacagcgagcaggattcctactgggtggagaacctcatggtc
caggagctggagcacttcaaccctccctttaagctgtgtcttcataagcgagacttcgtc
cctggcaagtggattatcgacaacatcattgactccattgaaaagagccgcaaaaccatc
tttgtgctttcggagaactttgtgcggagcgagtggtgcaagtatgagctggacttctcc
cacttccgtctctttgatgagaacaatgatgctgccattctgattctgctggagcccatt
gacaagaaggccatcccccagcgcttctgtaagctgcggaagatcatgaacaccaagacc
tacctggagtggcccacggatgagactcagcaggaagcgttctggttgaatttgagagct
gcaataaggtcctag

DBGET integrated database retrieval system