Capra hircus (goat): 100860785 Help Entry 100860785         CDS       T02910                                  Symbol IL6 Name (RefSeq) interleukin-6 precursor   KO K05405   interleukin 6 Organism chx  Capra hircus (goat) Pathway chx01521   EGFR tyrosine kinase inhibitor resistance chx01523   Antifolate resistance chx04060   Cytokine-cytokine receptor interaction chx04061   Viral protein interaction with cytokine and cytokine receptor chx04066   HIF-1 signaling pathway chx04068   FoxO signaling pathway chx04151   PI3K-Akt signaling pathway chx04218   Cellular senescence chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04625   C-type lectin receptor signaling pathway chx04630   JAK-STAT signaling pathway chx04640   Hematopoietic cell lineage chx04657   IL-17 signaling pathway chx04659   Th17 cell differentiation chx04668   TNF signaling pathway chx04672   Intestinal immune network for IgA production chx04931   Insulin resistance chx04932   Non-alcoholic fatty liver disease chx04933   AGE-RAGE signaling pathway in diabetic complications chx04936   Alcoholic liver disease chx05010   Alzheimer disease chx05020   Prion disease chx05022   Pathways of neurodegeneration - multiple diseases chx05132   Salmonella infection chx05133   Pertussis chx05134   Legionellosis chx05135   Yersinia infection chx05142   Chagas disease chx05143   African trypanosomiasis chx05144   Malaria chx05146   Amoebiasis chx05152   Tuberculosis chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05202   Transcriptional misregulation in cancer chx05321   Inflammatory bowel disease chx05323   Rheumatoid arthritis chx05332   Graft-versus-host disease chx05410   Hypertrophic cardiomyopathy chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100860785 (IL6)    04668 TNF signaling pathway     100860785 (IL6)    04066 HIF-1 signaling pathway     100860785 (IL6)    04068 FoxO signaling pathway     100860785 (IL6)    04151 PI3K-Akt signaling pathway     100860785 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100860785 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     100860785 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     100860785 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100860785 (IL6)    04620 Toll-like receptor signaling pathway     100860785 (IL6)    04621 NOD-like receptor signaling pathway     100860785 (IL6)    04623 Cytosolic DNA-sensing pathway     100860785 (IL6)    04625 C-type lectin receptor signaling pathway     100860785 (IL6)    04659 Th17 cell differentiation     100860785 (IL6)    04657 IL-17 signaling pathway     100860785 (IL6)    04672 Intestinal immune network for IgA production     100860785 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100860785 (IL6)    05202 Transcriptional misregulation in cancer     100860785 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100860785 (IL6)    05161 Hepatitis B     100860785 (IL6)    05171 Coronavirus disease - COVID-19     100860785 (IL6)    05164 Influenza A     100860785 (IL6)    05162 Measles     100860785 (IL6)    05168 Herpes simplex virus 1 infection     100860785 (IL6)    05163 Human cytomegalovirus infection     100860785 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     100860785 (IL6)    05169 Epstein-Barr virus infection     100860785 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     100860785 (IL6)    05135 Yersinia infection     100860785 (IL6)    05133 Pertussis     100860785 (IL6)    05134 Legionellosis     100860785 (IL6)    05152 Tuberculosis     100860785 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     100860785 (IL6)    05144 Malaria     100860785 (IL6)    05142 Chagas disease     100860785 (IL6)    05143 African trypanosomiasis     100860785 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     100860785 (IL6)    05321 Inflammatory bowel disease     100860785 (IL6)    05332 Graft-versus-host disease     100860785 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     100860785 (IL6)    05020 Prion disease     100860785 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     100860785 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100860785 (IL6)    05410 Hypertrophic cardiomyopathy     100860785 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100860785 (IL6)    04932 Non-alcoholic fatty liver disease     100860785 (IL6)    04931 Insulin resistance     100860785 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     100860785 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100860785 (IL6)    01523 Antifolate resistance     100860785 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     100860785 (IL6) Cytokines and neuropeptides [BR:chx04052]  Cytokines   Interleukins    100860785 (IL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL23 GCSF Beta-prop_NUP159_NUP214 Lipoprotein_6 MIP-T3_C Sec16 Motif Other DBs NCBI-GeneID:  100860785 NCBI-ProteinID:  NP_001272569 UniProt:  Q28319 E3UT57 LinkDB All DBs Position 4:complement(89125124..89129007) Genome browser AA seq 208 aa AA seqDB search MNSLFTSAFSPLAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPSRLLLTTPEKTEALIKHI VDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLL EYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATNTDMLEKMQSSNE WVKNAKVIIILRSLENFLQFSLRAIRMK NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgaactccctcttcacaagcgccttcagtccactcgctgtctccctggggctgctcctg gtgatgacttctgctttccctaccccgggtcccctgggagaagatttcaagaatgacacc accccaagcagactacttctgaccactccagaaaaaaccgaagctctcattaagcacatc gtcgacaaaatctctgcaataagaaaggagatatgtgaaaagaatgacgagtgtgaaaac agcaaggagacactggcagaaaataagctgaaacttccaaaaatggaggaaaaagatgga tgcttccaatctgggttcaatcaggcgatttgcttgatcaaaaccactgctggtcttctg gagtatcagatatacctggacttcctccagaacgagtttgagggaaatcaggaaactgtc atggagttgcagagcagtatcagaacactgatccagatcctgaaggaaaagatcgcaggt ctaataaccactccagccacaaacactgacatgctggagaagatgcagtcctcaaacgag tgggtaaagaacgcaaaggttatcatcatcctgagaagccttgagaatttcctgcagttc agcctgagagctattcggatgaagtag

DBGET integrated database retrieval system