KEGG   Capra hircus (goat): 100860785
Entry
100860785         CDS       T02910                                 

Gene name
IL6, IL-6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01523  Antifolate resistance
chx04060  Cytokine-cytokine receptor interaction
chx04061  Viral protein interaction with cytokine and cytokine receptor
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04218  Cellular senescence
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04640  Hematopoietic cell lineage
chx04657  IL-17 signaling pathway
chx04659  Th17 cell differentiation
chx04668  TNF signaling pathway
chx04672  Intestinal immune network for IgA production
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05010  Alzheimer disease
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05133  Pertussis
chx05134  Legionellosis
chx05135  Yersinia infection
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05144  Malaria
chx05146  Amoebiasis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05321  Inflammatory bowel disease
chx05323  Rheumatoid arthritis
chx05332  Graft-versus-host disease
chx05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100860785 (IL6)
   04668 TNF signaling pathway
    100860785 (IL6)
   04066 HIF-1 signaling pathway
    100860785 (IL6)
   04068 FoxO signaling pathway
    100860785 (IL6)
   04151 PI3K-Akt signaling pathway
    100860785 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100860785 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100860785 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100860785 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100860785 (IL6)
   04620 Toll-like receptor signaling pathway
    100860785 (IL6)
   04621 NOD-like receptor signaling pathway
    100860785 (IL6)
   04623 Cytosolic DNA-sensing pathway
    100860785 (IL6)
   04625 C-type lectin receptor signaling pathway
    100860785 (IL6)
   04659 Th17 cell differentiation
    100860785 (IL6)
   04657 IL-17 signaling pathway
    100860785 (IL6)
   04672 Intestinal immune network for IgA production
    100860785 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860785 (IL6)
   05202 Transcriptional misregulation in cancer
    100860785 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100860785 (IL6)
   05321 Inflammatory bowel disease
    100860785 (IL6)
   05332 Graft-versus-host disease
    100860785 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100860785 (IL6)
   05020 Prion disease
    100860785 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    100860785 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100860785 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100860785 (IL6)
   04931 Insulin resistance
    100860785 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100860785 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100860785 (IL6)
   05135 Yersinia infection
    100860785 (IL6)
   05133 Pertussis
    100860785 (IL6)
   05134 Legionellosis
    100860785 (IL6)
   05152 Tuberculosis
    100860785 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100860785 (IL6)
   05161 Hepatitis B
    100860785 (IL6)
   05171 Coronavirus disease - COVID-19
    100860785 (IL6)
   05164 Influenza A
    100860785 (IL6)
   05162 Measles
    100860785 (IL6)
   05168 Herpes simplex virus 1 infection
    100860785 (IL6)
   05163 Human cytomegalovirus infection
    100860785 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100860785 (IL6)
   05169 Epstein-Barr virus infection
    100860785 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100860785 (IL6)
   05144 Malaria
    100860785 (IL6)
   05142 Chagas disease
    100860785 (IL6)
   05143 African trypanosomiasis
    100860785 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100860785 (IL6)
   01523 Antifolate resistance
    100860785 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100860785 (IL6)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interleukins
   100860785 (IL6)
SSDB
Motif
Pfam: IL6 IL23 GCSF Sec16 MIP-T3_C Lipoprotein_6
Other DBs
NCBI-GeneID: 100860785
NCBI-ProteinID: NP_001272569
UniProt: Q28319 E3UT57
LinkDB
Position
4
AA seq 208 aa
MNSLFTSAFSPLAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPSRLLLTTPEKTEALIKHI
VDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLL
EYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATNTDMLEKMQSSNE
WVKNAKVIIILRSLENFLQFSLRAIRMK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaactccctcttcacaagcgccttcagtccactcgctgtctccctggggctgctcctg
gtgatgacttctgctttccctaccccgggtcccctgggagaagatttcaagaatgacacc
accccaagcagactacttctgaccactccagaaaaaaccgaagctctcattaagcacatc
gtcgacaaaatctctgcaataagaaaggagatatgtgaaaagaatgacgagtgtgaaaac
agcaaggagacactggcagaaaataagctgaaacttccaaaaatggaggaaaaagatgga
tgcttccaatctgggttcaatcaggcgatttgcttgatcaaaaccactgctggtcttctg
gagtatcagatatacctggacttcctccagaacgagtttgagggaaatcaggaaactgtc
atggagttgcagagcagtatcagaacactgatccagatcctgaaggaaaagatcgcaggt
ctaataaccactccagccacaaacactgacatgctggagaagatgcagtcctcaaacgag
tgggtaaagaacgcaaaggttatcatcatcctgagaagccttgagaatttcctgcagttc
agcctgagagctattcggatgaagtag

DBGET integrated database retrieval system