KEGG   Capra hircus (goat): 100861254
Entry
100861254         CDS       T02910                                 

Gene name
BCL2, bcl-2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04064  NF-kappa B signaling pathway
chx04066  HIF-1 signaling pathway
chx04071  Sphingolipid signaling pathway
chx04115  p53 signaling pathway
chx04140  Autophagy - animal
chx04141  Protein processing in endoplasmic reticulum
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04215  Apoptosis - multiple species
chx04217  Necroptosis
chx04261  Adrenergic signaling in cardiomyocytes
chx04340  Hedgehog signaling pathway
chx04510  Focal adhesion
chx04621  NOD-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04915  Estrogen signaling pathway
chx04928  Parathyroid hormone synthesis, secretion and action
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05014  Amyotrophic lateral sclerosis
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05162  Measles
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05215  Prostate cancer
chx05222  Small cell lung cancer
chx05226  Gastric cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100861254 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100861254 (BCL2)
   04630 JAK-STAT signaling pathway
    100861254 (BCL2)
   04064 NF-kappa B signaling pathway
    100861254 (BCL2)
   04066 HIF-1 signaling pathway
    100861254 (BCL2)
   04071 Sphingolipid signaling pathway
    100861254 (BCL2)
   04151 PI3K-Akt signaling pathway
    100861254 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100861254 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    100861254 (BCL2)
   04215 Apoptosis - multiple species
    100861254 (BCL2)
   04217 Necroptosis
    100861254 (BCL2)
   04115 p53 signaling pathway
    100861254 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100861254 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100861254 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100861254 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    100861254 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100861254 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    100861254 (BCL2)
   04722 Neurotrophin signaling pathway
    100861254 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100861254 (BCL2)
   05206 MicroRNAs in cancer
    100861254 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100861254 (BCL2)
   05226 Gastric cancer
    100861254 (BCL2)
   05215 Prostate cancer
    100861254 (BCL2)
   05222 Small cell lung cancer
    100861254 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100861254 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100861254 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100861254 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100861254 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100861254 (BCL2)
   05152 Tuberculosis
    100861254 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100861254 (BCL2)
   05161 Hepatitis B
    100861254 (BCL2)
   05162 Measles
    100861254 (BCL2)
   05168 Herpes simplex virus 1 infection
    100861254 (BCL2)
   05169 Epstein-Barr virus infection
    100861254 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100861254 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100861254 (BCL2)
   01524 Platinum drug resistance
    100861254 (BCL2)
   01522 Endocrine resistance
    100861254 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    100861254 (BCL2)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100861254 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100861254
NCBI-ProteinID: NP_001301142
UniProt: A0A076FZV9
LinkDB
Position
24
AA seq 229 aa
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGAAGAAPPGAAPAPGILSSQPGRTPAPS
RTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF
ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHAWIQ
DNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcgcacgcggggggcacaggctacgataaccgcgagatcgtgatgaagtacatccac
tacaagctgtcgcagcgcggctacgagtgggatgccggagccgcgggcgccgcgcccccc
ggggccgctcccgcgccgggcatcctgtcctcccagccgggccgcacacccgcgccctcc
aggacctccccgccgccgcccccggccgccgccgccgggcctgcgcccagcccggtgcca
cctgtggtccacctgaccctgcgccaggccggcgatgacttctctcggcgctaccgccgc
gacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcgaggggacgcttc
gccacggtggtggaggagctcttcagggacggggtgaactgggggcgcatcgtggccttc
tttgagttcggaggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtg
gacagcatcgccctgtggatgaccgagtacctgaaccggcacctgcacgcctggatccag
gacaacggaggctgggacgcctttgtggagctgtacggccctagcatgcggcccctgttt
gatttctcctggctgtctctgaaggcactgctcagtctggccctggtgggcgcttgcatc
accctgggtgcctatctgggccataagtga

DBGET integrated database retrieval system