KEGG   Coccidioides immitis: CIMG_10236Help
Entry
CIMG_10236        CDS       T01114                                 

Definition
(RefSeq) mismatch-specific thymine-DNA glycosylate (mug)
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
cim  Coccidioides immitis
Pathway
cim03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cim00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CIMG_10236
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cim03400]
    CIMG_10236
Enzymes [BR:cim01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     CIMG_10236
DNA repair and recombination proteins [BR:cim03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CIMG_10236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 4558031
NCBI-ProteinID: XP_001239214
UniProt: A0A0E1RUI5
LinkDB All DBs
AA seq 324 aa AA seqDB search
MPNEDISSSAPLTSFNGVLDKYVHISPSKNGRAEQQPASPTKRSSPLKRKLEDAGSEPGG
DVASLLSEPFSRPPISPTRRTTRSQSAQTLEKPCRPSPTKRTRSFKSAPPASDLATPSGP
ISLLHDTIPQGLILLFIGVNPGIMTGQTGFVYAHPSNLYWKLLHWSGITMRQHPPSDTYR
LPELYGVGNTNIVARPTRDASMLSKAEMDAGVPVLEEKVRRNRPEAVCLVGKSIWEAIWR
VRKGKNIKKEEFRYGWQDESENMGVIKPGEGDNEEWKGARVFVATTTSGLAATMSLAEKK
AVWNELGAWVKQKREERNFVPNVN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacgaggacatttccagttccgcgccattgacctctttcaacggtgtcctcgac
aaatatgttcacatctcgccatctaagaatggacgagcagagcaacagcctgcttcgccc
accaaaagatcatcaccattgaaacgaaaactcgaagacgctggcagtgaacccgggggc
gatgtcgcatcgctgctcagtgaacccttctcgcggcccccgatatccccaacccgacga
acgacccggtctcaatccgcccaaaccctcgagaaaccttgtcgtccgtcccccacgaaa
cgcacccgcagctttaaatccgctccaccggcctccgacctagccacaccaagcggcccg
atcagcctgctgcacgacaccattccccaaggccttattcttctctttatcggcgtcaat
cccggcatcatgacaggccaaactggcttcgtctacgcccacccgtccaatctatactgg
aaactccttcattggtcgggcataacgatgcgtcaacatccgcctagcgatacgtatcgg
cttccggagctgtacggcgtgggtaatacgaacatcgtggcgcgcccgacgcgcgacgcg
agtatgttgtccaaggcggagatggatgcgggtgtgccggtacttgaagagaaagtgagg
agaaataggcccgaggctgtgtgtctggttgggaagagcatctgggaagcaatttggagg
gtgaggaaagggaaaaatattaaaaaggaggagtttaggtatgggtggcaggatgaaagt
gagaatatgggagtgataaagccgggagaaggagacaacgaggagtggaaaggagcgagg
gtattcgtcgctacgacgacaagcggattagctgcgaccatgtctttggcggagaagaaa
gcggtatggaatgagttgggagcttgggtaaagcagaagagagaggaaaggaattttgtg
cctaacgttaactga

DBGET integrated database retrieval system