KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385398
Entry
100385398         CDS       T03264                                 

Gene name
TREX1
Definition
(RefSeq) three prime repair exonuclease 1
  KO
K10790  three prime repair exonuclease 1 [EC:3.1.11.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100385398 (TREX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100385398 (TREX1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     100385398 (TREX1)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Nucleases
    100385398 (TREX1)
SSDB
Motif
Pfam: DUF2733 RNase_T
Other DBs
NCBI-GeneID: 100385398
NCBI-ProteinID: XP_008979843
Ensembl: ENSCJAG00000037061
UniProt: F7E304
LinkDB
Position
15
AA seq 314 aa
MGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALENPPTSQGPPPIVPPP
PRVVDKLSLCVAPGKACSPAAINITGLSTAVLAAHGRQCFDDNLANLLLAFLQRQPQPWC
LVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDSITALKALERAGSPSEHGPRKSYSLG
SIYTRLYGKSPPDSHTAEGDVLALLSICQWRPQALLRWVDAHARPFSTIRPMYGVTASAS
TKPRPSAVTATLHLATTSNASPSLGGSRRPKDLPPVEDSEVPRREGLLAPLGLLAVLTLA
VATLYGLFLAAPGE
NT seq 945 nt   +upstreamnt  +downstreamnt
atgggctcacaggccctgcccccagggcccatgcagaccctcatcttcttcgacatggag
gccactggtttgcctttctcccagcccaaggtcacggagctgtgcctgctggctgtccac
agatgtgccctggagaacccccctacgtctcaggggccacctcccatagttcctccacca
ccacgtgtggtggacaagctttccctgtgtgtggctcccgggaaggcctgcagccctgca
gccatcaacatcacaggtctgagcacagctgtgctggcagcacatgggcgtcagtgtttt
gatgacaacctggccaacctgctcctagccttcctacagcgccagccacagccctggtgc
ctggtggcacacaatggtgaccgctacgacttccccctgctccaagcagagctggctatg
ctgggcctcaccagtgctctggatggtgccttctgtgtggatagcatcactgcactgaag
gccctggagcgagcgggtagcccctcagagcacggcccaaggaagagctatagcctgggc
agcatctacacacgcctgtacgggaagtcccctccggactcgcacacggctgagggcgat
gtcctggccctactcagtatctgtcagtggagaccacaggcactgctgcggtgggtggat
gctcatgccaggcccttcagcaccatcagacccatgtatggggtcacagcctctgctagt
accaagccaagaccatctgctgtcacagccactctacacctggccacaaccagcaatgct
agtccaagccttggagggagcaggagacccaaggatcttcctccagtggaggactctgaa
gtcccacgcagggaggggctgctggccccactgggtctgctggctgtcctgaccttggca
gtagccacgttgtatggactattcctggccgcacctggggagtag

DBGET integrated database retrieval system