KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385618
Entry
100385618         CDS       T03264                                 

Gene name
CASP1
Definition
(RefSeq) caspase 1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04217  Necroptosis
cjc04613  Neutrophil extracellular trap formation
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc05014  Amyotrophic lateral sclerosis
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05135  Yersinia infection
cjc05164  Influenza A
cjc05171  Coronavirus disease - COVID-19
cjc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100385618 (CASP1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100385618 (CASP1)
   04621 NOD-like receptor signaling pathway
    100385618 (CASP1)
   04623 Cytosolic DNA-sensing pathway
    100385618 (CASP1)
   04625 C-type lectin receptor signaling pathway
    100385618 (CASP1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100385618 (CASP1)
   05164 Influenza A
    100385618 (CASP1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100385618 (CASP1)
   05135 Yersinia infection
    100385618 (CASP1)
   05133 Pertussis
    100385618 (CASP1)
   05134 Legionellosis
    100385618 (CASP1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100385618 (CASP1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100385618 (CASP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cjc01002]
    100385618 (CASP1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100385618 (CASP1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     100385618 (CASP1)
Peptidases and inhibitors [BR:cjc01002]
 Cysteine peptidases
  Family C14: caspase family
   100385618 (CASP1)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100385618 (CASP1)
SSDB
Motif
Pfam: Peptidase_C14 CARD Cdh1_DBD_1
Other DBs
NCBI-GeneID: 100385618
NCBI-ProteinID: XP_009004947
Ensembl: ENSCJAG00000009842
LinkDB
Position
11
AA seq 389 aa
MADKILKEKRRLFIRSVGEGTINGLLDELLEKGVLNEEEIEKVKRENATVMDKARALLDS
VIRKGARACQVCITYICEEDRHLAEKLGLSADSQEALPSFPAPPAVQNKPLMRSEGNVKL
CPPGEAERIKKEQSAEIYPTMDKSSRTRLALIICNEEFDSLSRRTGAEVDITGMEILLKN
LGYSVDVRKNLTASEMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKYSEQVPDI
LRVNEIFRNLNTRNCPSLKDKPKVIIIQACRGENEGVVWLKDSAGVSENTSLPTTEAFED
DAIGKAHIEKDFIAFCSSTPDNVSWRHPTKGSVFIMRLIEHLQEYACSCDVEEIFRKVRL
SFERTDGRVQMPTAERVTLTRRFYLFPGC
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggctgacaagatcctgaaggagaagaggaggctctttatccgttcagtgggtgaaggt
acaataaatggcttactggatgaattactagagaaaggggtgctgaacgaggaagagatt
gagaaagtaaaacgtgaaaatgccacagtcatggataaggcccgagctttgcttgactct
gttattcggaagggggctcgggcatgccaagtttgcatcacgtacatttgtgaagaggat
cgtcacctggcagagaagctgggcctctcagcagattctcaagaagcacttccgtccttc
ccagctcctccggcagtgcagaacaagccactgatgcgctcagaagggaatgtcaagctt
tgccccccaggagaagctgaaaggataaagaaggaacagtcggcagagatttatccaaca
atggacaagtcaagccgcacacgtcttgctctcattatctgcaatgaagaatttgacagt
ctttctagaagaactggagctgaggttgacatcacaggcatggaaatactgctaaaaaat
ctggggtacagtgtggatgtgagaaaaaatctcactgcttcagaaatgactacagagctg
gaggcgtttgcacaccgcccagagcacaagacctctgatagcacgttcctggtgttcatg
tctcatggtattcgggaaggcatttgtgggaagaaatactctgagcaagtccccgatata
ttacgagtcaatgaaatctttagaaatttgaataccaggaactgcccaagtttgaaggac
aaacccaaggtgatcatcatccaggcctgtcgtggtgagaacgaaggtgtggtgtggtta
aaagactcagcaggagtctctgaaaacacatctttaccaactacagaagcttttgaagat
gatgccattgggaaagcccacatagagaaggattttattgctttctgctcttccacacca
gataatgtttcttggagacatcccacaaagggctctgtttttattatgagactcattgaa
catttgcaagaatatgcctgttcctgtgatgtggaggaaattttccgcaaggttcgactt
tcatttgagcgaacagatggtagagtgcagatgcccaccgctgaaagggtgactttgaca
agacgtttctacctcttcccaggatgttaa

DBGET integrated database retrieval system