KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390347
Entry
100390347         CDS       T03264                                 

Gene name
PLCG2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00562  Inositol phosphate metabolism
cjc01100  Metabolic pathways
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04020  Calcium signaling pathway
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04072  Phospholipase D signaling pathway
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04611  Platelet activation
cjc04625  C-type lectin receptor signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04919  Thyroid hormone signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04935  Growth hormone synthesis, secretion and action
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05214  Glioma
cjc05223  Non-small cell lung cancer
cjc05225  Hepatocellular carcinoma
Module
cjc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100390347 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100390347 (PLCG2)
   04014 Ras signaling pathway
    100390347 (PLCG2)
   04370 VEGF signaling pathway
    100390347 (PLCG2)
   04064 NF-kappa B signaling pathway
    100390347 (PLCG2)
   04066 HIF-1 signaling pathway
    100390347 (PLCG2)
   04020 Calcium signaling pathway
    100390347 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100390347 (PLCG2)
   04072 Phospholipase D signaling pathway
    100390347 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100390347 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    100390347 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    100390347 (PLCG2)
   04662 B cell receptor signaling pathway
    100390347 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    100390347 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    100390347 (PLCG2)
   04670 Leukocyte transendothelial migration
    100390347 (PLCG2)
   04062 Chemokine signaling pathway
    100390347 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100390347 (PLCG2)
   04919 Thyroid hormone signaling pathway
    100390347 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100390347 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100390347 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    100390347 (PLCG2)
   04380 Osteoclast differentiation
    100390347 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390347 (PLCG2)
   05206 MicroRNAs in cancer
    100390347 (PLCG2)
   05205 Proteoglycans in cancer
    100390347 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100390347 (PLCG2)
   05214 Glioma
    100390347 (PLCG2)
   05223 Non-small cell lung cancer
    100390347 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100390347 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100390347 (PLCG2)
   05171 Coronavirus disease - COVID-19
    100390347 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100390347 (PLCG2)
   05169 Epstein-Barr virus infection
    100390347 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100390347 (PLCG2)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100390347 (PLCG2)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100390347 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100390347 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 100390347
NCBI-ProteinID: XP_008984521
Ensembl: ENSCJAG00000016515
LinkDB
Position
20
AA seq 1265 aa
MSTMASVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGNQFVLSTLSLAADSKEDAV
NWLSGLKILHQEVMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQNMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGRPVIYHGWTRTTKIKFDDVVQAIRDHAFVTSSFPVILSIEEHCSVEQQRHMAKV
FKDVFGDLLLMKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTVEEEVPQDIPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMENGTLKYY
LTDNVTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADVEELEKQII
EDNPLGSLCRGILDLNTYNVVKAAQGKNQKPFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSIIRQKPVDLLKYNQKGLTRIYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKY
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKPGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKAIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLXRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgtccaccatggccagtgtggattcccttgcggaatatgagaagagccagatcaagaga
gccctggagctggggacggtgatgactgtgttcagcttccgcaagtctactcctgagcga
aggaccgtccaggtgatcatggagacgaggcaggtggcctggagcaagaccgccgacaag
atcgagggcttcttggatatcatggaaataaaagaaatccgcccagggaagaactccaaa
gatttcgagcgtgctaaagcagttcgccagaaagaagactgctgcttcaccatcctatat
ggcaatcagttcgtcctcagcacactcagcttggcagctgactctaaagaggatgcagtt
aactggctctctggcttgaaaatcttacaccaagaagtgatgaatgcatccacacccacc
attatcgagagttggctgagaaagcagatatattctgtggatcaaaccagaagaaacagc
atcagcctccgagagttgaagaccatcttgcccctggtcaacttcaaagtgagcagtgcc
aagttccttaaagataagtttgtggaaataggagcacacaaagatgagctcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcaaaaatcgattctcgatgaa
ttcaaaaaggattcgtctgtgttcatcctggggaacacggacaggccggatgcctctgct
gtttaccttcatgactttcagaggtttctcatacatgaacagcaggagcactgggctcag
gatctgaataaagtccgtgagcggatgacaaaattcatcgatgacaccatgcgtgaaact
gctgagcctttcttgttcgtggatgagtttctcacatacctgttttcacgagaaaacagc
atctgggatgagaagtatgacgcggtggacatgcagaacatgaacaaccccctgtctcat
tactggatctcctcatcacataacacgtacctcacaggtgaccagctgcggagtgagtcg
tccacagaggcctacatccgctgtctgcgcatgggctgtcgctgcattgaattggactgc
tgggacgggcccgatgggaggccggtcatctaccatggctggacgcggaccactaagatc
aagtttgatgatgtcgtgcaggccatcagggaccacgcctttgtgacctcgagcttccca
gtgatcctgtccatcgaggagcattgcagcgtggagcagcagcgccacatggccaaggtc
ttcaaagacgtatttggcgaccttcttctgatgaagcccacggaggccagtgctgaccag
ctgccctcacccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggtgacgtggatgtcaacgtggaggacaagaaggatgagcataagcaacagggagag
ctgtacatgtgggattccatcgaccagaaatggactcggcactactgcgccatcgccgac
gccaagctgtccttcagtgatgacattgaacagactgtggaggaggaagtgccccaggat
atacccccaacagagctgcattttggggagaaatggttccacaagaaggtggagaagagg
acgagtgctgagaagttgctgcaggaatactgcatggagacagggggcaaggatggcacc
ttcctggttcgtgagagcgagaccttccccaatgactacactctgtccttctggcggtca
ggccgggtccagcactgccggatacgctccaccatggagaatgggaccctgaagtactac
ctgactgacaacgtcaccttcagcagcatctacgccctcatccagcactaccgcgagacg
catctgcgctgtgccgaatttgagctgcggctcacggaccctgtgcccaaccccaacccc
cacgagtccaagccgtggtactatgacagcctaagccgcggagaggcagaggacatgctg
atgaggatcccccgcgacggagccttcctgatccgaaagcgagagggcagcgactcctac
gccatcaccttcagggctaggggcaaggtgaagcattgtcgcatcaaccgggacggccgg
cactttgtgctgggaacctccgcctattttgagagcctggtggagcttgtcagttactat
gagaagcattcactctaccgaaagatgagactgcgctaccccgtgacgcccgagctcctg
gagcgctacaatatggaaagagatataaactccctctatgacgtcagcagaatgtatgtg
gatcccagtgaaatcaatccgtccatgcctcagagaactgtgaaagctctgtatgactac
aaagccaagcgaagcgatgagctgagcttctgccgtggcgccctcatccacaatgtctcc
aaggagcctgggggctggtggaaaggtgactatggaaccaggatccagcagtacttccca
tccaactatgtggaggacatctcaactgcagatgtcgaggagctggaaaagcagattatt
gaagacaatcccttagggtctctttgcagaggcatactggacctcaatacctataacgtc
gtgaaagccgcacaggggaaaaaccagaagccctttgtctttatcctggagcccaagaag
cagggcgatcctccggtggagtttgccacagacagggtggaggagctgttcgagtggttt
cagagcatccgagagatcacctggaagattgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctctgacctggttgtctactgcaaaccaacc
agcaaaaccaaggacaacttagaaaatcctgactttagagaaatccgctcctttgtggag
acaaaggctgacagcatcatcagacagaagcccgtcgacctcctcaagtacaatcaaaag
ggcctgacccgcatctacccaaagggacaaagagttgactcttccaattatgaccccttc
cgcctgtggctctgcggttctcagatggtggcactcaatttccagacagcagataagtac
atgcagatgaatcacgcgttgttttctctcaatgggcgcacgggctacgttctgcagcct
gagagcatgaggacagagaaatatgacccaatgccacccgagtcccagaggaagatcctg
atgacgctgactgtcaaggttctcggtgctcgccatctccccaaacctggacgaagtatt
gcctgtccctttgtagaagtggagatctgtggagctgagtatgacaacaacaagttcaaa
acgacggttgtgaatgataatggcctcagccctatctgggctccaacacaggagaaggtg
acatttgaaatttatgacccaaacctggcatttctgcgcttcgtggtttacgaagaagat
atgttcagtgatcccaactttcttgctcatgccacttaccccattaaagcaatcaaatca
ggattcaggtctgttcctctgaagaatgggtacagtgaggacatcgagctggcttccctc
ctggttttctgtgaaatgcggccagtcctggagagcgaagaggaactttactcctcctgt
cgccagctgnagcggcggcaagaagaactgaacaaccagctctttctgtatgacacacac
cagaacctgcgcaatgccaaccgggatgccctggttaaagagttcaacgttaatgagaac
cagctccagctgtaccaggagaaatgcaacaggaggttaagagagaagagagtcagcaac
agcaagttttactcgtag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397497
Entry
100397497         CDS       T03264                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00562  Inositol phosphate metabolism
cjc01100  Metabolic pathways
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04072  Phospholipase D signaling pathway
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04919  Thyroid hormone signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04935  Growth hormone synthesis, secretion and action
cjc05012  Parkinson disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05135  Yersinia infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05214  Glioma
cjc05223  Non-small cell lung cancer
cjc05225  Hepatocellular carcinoma
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
cjc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100397497 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100397497 (PLCG1)
   04014 Ras signaling pathway
    100397497 (PLCG1)
   04015 Rap1 signaling pathway
    100397497 (PLCG1)
   04370 VEGF signaling pathway
    100397497 (PLCG1)
   04064 NF-kappa B signaling pathway
    100397497 (PLCG1)
   04066 HIF-1 signaling pathway
    100397497 (PLCG1)
   04020 Calcium signaling pathway
    100397497 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100397497 (PLCG1)
   04072 Phospholipase D signaling pathway
    100397497 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100397497 (PLCG1)
   04660 T cell receptor signaling pathway
    100397497 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100397497 (PLCG1)
   04659 Th17 cell differentiation
    100397497 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100397497 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100397497 (PLCG1)
   04670 Leukocyte transendothelial migration
    100397497 (PLCG1)
   04062 Chemokine signaling pathway
    100397497 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100397497 (PLCG1)
   04919 Thyroid hormone signaling pathway
    100397497 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100397497 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100397497 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    100397497 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397497 (PLCG1)
   05206 MicroRNAs in cancer
    100397497 (PLCG1)
   05205 Proteoglycans in cancer
    100397497 (PLCG1)
   05231 Choline metabolism in cancer
    100397497 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100397497 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100397497 (PLCG1)
   05214 Glioma
    100397497 (PLCG1)
   05223 Non-small cell lung cancer
    100397497 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100397497 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    100397497 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100397497 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100397497 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100397497 (PLCG1)
   05171 Coronavirus disease - COVID-19
    100397497 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100397497 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100397497 (PLCG1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100397497 (PLCG1)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100397497 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100397497 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 GDPD PH_12 PH_9
Other DBs
NCBI-GeneID: 100397497
NCBI-ProteinID: XP_008994187
Ensembl: ENSCJAG00000018013
LinkDB
Position
5
AA seq 1296 aa
MAGAASPCANGCGPSAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGVDKIEGAQXVLDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRL
KTLSLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDL
KNMLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEAST
LRAGERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFVDE
FVTFLFSKENSVWNSQLDAVCPDTMNNPSFHYWISSSHNTYLTGDQFSSESSLEAYARCL
RMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHC
SIAQQRNMAQYFKKVLGDTLLTKPVDISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPT
SVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKE
VSSSTELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTL
SFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPV
PQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRV
QQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEG
RNPGFYVEANPMPTFKVQLRPLALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGG
KKQLWFPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLF
VFSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLSEGKMMERRKKIALELSE
LVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKG
QRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFD
PFDKSSLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNG
LNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNN
YSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQ
QPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3891 nt   +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgcgccaacggctgcgggcccagcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactct
aagaagtcgcagcgacccgagcggaagaccttccaggtcaagctggagacgcgccagatc
acgtggagccggggcgtcgacaagatcgagggggcccagtaagtgcttgatattcgagaa
atcaaggagatccgcccagggaagacctcacgggactttgatcgctatcaagaggacccc
gctttccggccggaccagtcacactgctttgtcattctctatggaatggaattccgcctg
aagaccctgagcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggctta
acttggctgatggaggatacattacaggcacccacacccctgcagattgagaggtggctc
cggaagcaattttactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctg
aagaacatgctgtcacaggtcaattaccgggtccccaacatgcgcttcctccgagagcgc
ctgacggacctggagcagcgcagcggggacatcacctatgggcagtttgctcaactgtac
cgcagcctcatgtacagcgcccagaagacgatggatctccccttcttggaagccagtact
ctgagggctggggagcggccagagctttgccgagtgtcccttcctgagttccagcagttc
ctccttgactaccagggggagctgtgggctgttgatcgcctccaggtgcaggagttcatg
ctcagcttcctccgagaccccttgcgagagattgaggagccatactttttcgtggatgag
tttgtcaccttcctgttctccaaagagaacagtgtgtggaactcgcagctggacgctgta
tgcccggacaccatgaacaacccctctttccactactggatctcctcctcccacaacacg
tacctgaccggggaccagttctccagtgagtcctccctggaagcctacgctcgctgcctg
cggatgggctgtcgctgcattgagttggactgctgggatggtccagatgggatgccagtc
atttaccatgggcacacccttaccaccaagatcaagttctcagatgtcctgcacaccatc
aaggagcatgcctttgtggcctcagagtacccagtcatcctttccatcgaggaccactgc
agcattgcccagcagagaaacatggcccagtacttcaagaaggttctgggggacacactc
ctcaccaagcccgtggatatctctgccgatgggctcccctcacccaaccagcttaagaga
aagatcctcatcaagcacaagaagctggctgagggcagtgcctacgaggaggtgcctaca
tctgtgatgtactctgagaacgacatcagcaactccatcaagaatggcatcctctatctg
gaggaccctgtgaaccacgaatggtatccccactacttcgttctgaccagcagcaagatc
tactactctgaagagaccagcagtgaccagggcaatgaggatgaggaggagcccaaggag
gtcagcagcagcacagagctgcactccaatgagaaatggttccatgggaagcttggggca
gggcgtgatgggcggcacatcgctgagcgcctgcttactgagtactgcatcgagaccggg
gcccctgacggctccttcctcgttcgagagagtgagaccttcgtgggcgactacacgctc
tctttctggcggaacgggaaagttcagcactgccgtatccactcccggcaagatgctggg
acccccaagttcttcttgacagacaacctcgtctttgattccctctatgacctcatcaca
cactaccagcaggtgcccctgcgctgcaatgagtttgagatgcgactttcagaacctgtt
ccacagaccaacgcccatgagagcaaagagtggtaccatgcgagcctgactagagcacag
gctgagcacatgctaatgcgtgtcccccgtgatggggccttcctggtgcggaagcggaat
gagcccaactcatatgccatctctttccgggctgagggcaagatcaagcattgccgtgtc
cagcaggagggacagactgtgatgctagggaactcagagttcgacagccttgttgacctc
atcagctactatgagaagcacccgctgtaccgcaagatgaagctgcgttatcccatcaat
gaggaggcactggagaagattggcacagctgagcctgactacggggccctgtatgaggga
cgcaaccctggcttctacgtagaggcaaaccctatgccaactttcaaggtacagctcagg
cctctggccctctttgactacaaagcccagagggaagacgagctgaccttcaccaagagt
gctatcatccagaacgtggagaagcaagagggaggctggtggcgaggtgactatggaggg
aagaagcaactgtggttcccatcaaactatgtggaagagatggtcaaccccgtggccctg
gagccagagagggagcacttggacgagaacagccccctaggggacttgctgcggggggtc
ttggatgtaccagcttgtcagattgccatccgtcctgagggcaagaacaaccggctcttc
gtcttctccatcagcatggcatcagtggcccactggtccctggatgttgctgcagactca
caggaggagctgcaggactgggtgaaaaagattcgtgaagtggcccagaccgcagatgcc
aggctctctgaggggaagatgatggaacggaggaagaagattgccctggagctctctgag
cttgtcgtctactgccggcctgttcccttcgatgaagagaagattggcacagaacgtgct
tgctaccgggacatgtcgtccttcccggaaaccaaggctgagaaatacgtgaacaaggcc
aaaggcaagaagttccttcagtacaatcgactgcagctctcccgcatctaccccaagggc
cagcgactggattcctccaactatgatcctttgcccatgtggatctgtggcagccagctc
gtggccctcaacttccagacccctgacaagcctatgcagatgaaccaggccctcttcatg
acgggccggcactgtggctatgtgctgcagccaagtaccatgcgggacgaggccttcgac
ccctttgacaagagcagcctccgcgggctggagccatgtgccatctgtattgaggtgctg
ggggcccgacatctgccgaagaatggccgaggcattgtgtgtccttttgtggagattgag
gtggctggagctgagtatgacagcaccaagcagaagacagagtttgtggtggacaatgga
ctcaaccctgtatggccggccaagcccttccacttccagatcagtaaccctgaatttgcc
tttctgcgtttcgtggtgtatgaggaagacatgtttagtgaccagaatttcctggctcag
gctactttcccagtaaaaggcctgaagacaggatacagagcagtgcctttgaagaacaac
tacagcgaggacctggaattggcctccctgctgatcaagattgacattttccctgccaag
caagagaatggtgacctcagtcccttcagtggtacatccctgcgggagcgaggctcagat
gcctcaggccagctgtttcatggccgagcccgggaaggctcctttgagtcccgctaccag
cagccatttgaggacttccgcatctcccaggagcatctcgcagaccattttgacagtcga
gaacgaagggccccaagaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system