KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401039
Entry
100401039         CDS       T03264                                 

Gene name
KCNJ11
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 11
  KO
K05004  potassium inwardly-rectifying channel subfamily J member 11
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04911  Insulin secretion
cjc04929  GnRH secretion
cjc04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100401039 (KCNJ11)
   04929 GnRH secretion
    100401039 (KCNJ11)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100401039 (KCNJ11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100401039 (KCNJ11)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100401039 (KCNJ11)
SSDB
Motif
Pfam: IRK_C IRK EI24 Ion_trans_2
Other DBs
NCBI-GeneID: 100401039
NCBI-ProteinID: XP_009005996
UniProt: U3AZ89
LinkDB
Position
11
AA seq 390 aa
MLSRKGIIPEEYVLTRLAEDPAEPRYRARERRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPREGAAEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALT
LASARGPLRKRSVAMAKSKPKFSISPDSLS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgctgtcccgcaagggcatcatccccgaggagtacgtgctgacacgcctggcagaggac
cctgccgagcccaggtaccgtgcccgggagcggagggcccgctttgtgtccaagaaaggc
aattgcaacgtggcccacaagaacatccgggagcagggccgcttcctgcaggacgtgttc
accacgctggtggacctcaagtggccacacacgctgctcatcttcaccatgtccttcctg
tgcagctggctgctcttcgccatggcctggtggctcattgccttcgcccacggcgacttg
gcccccagggagggcgctgctgagccctgcgtcaccagtatccactccttttcatctgcc
ttccttttctccattgaggtccaagtgactattggctttggcgggcgcatggtgactgag
gagtgcccgcttgccatcctgatcctcatcgtgcagaacatcgtggggctcatgatcaac
gcaatcatgctgggctgcatcttcatgaagactgcccaggcccaccgcagggccgagacc
ctcatcttcagcaagcacgcggtgatcgccctgcgccacggccgcctctgcttcatgctg
cgtgtgggtgacctccgcaagagcatgatcatcagtgccaccatccacatgcaggtggtg
cgcaagaccaccagccccgagggcgaggtggtgcccctccaccaggtggacatccccatg
gagaacggcgtgggtggcaacagcatcttcctagtggccccgctgatcatctaccacgtc
atcgatgccaacagcccgctgtacgacctggcgcccagtgacctgcaccaccaccaggac
ctcgagattatcgtcatcctggaaggtgtggtggaaaccaccggcatcaccacccaggcc
cgcacttcctacctggctgatgagatcctgtggggccagcgttttgtccccatcgtagct
gaggaggacggacgctactctgtggactactccaagtttggcaacaccatcaaagtgccc
acaccactctgcacggcccgccagcttgatgaggaccacagcctactggaagctctgaca
ctcgcctcagcccgcggacccctgcgcaagcgcagcgtggccatggccaagtccaagccc
aagttcagcatctctccggattccctgtcctga

DBGET integrated database retrieval system