KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406790
Entry
100406790         CDS       T03264                                 

Gene name
MCL1
Definition
(RefSeq) BCL2 family apoptosis regulator
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04630  JAK-STAT signaling pathway
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100406790 (MCL1)
   04151 PI3K-Akt signaling pathway
    100406790 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100406790 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100406790 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 100406790
NCBI-ProteinID: XP_002759925
Ensembl: ENSCJAG00000006605
UniProt: F7GTF7
LinkDB
Position
18
AA seq 350 aa
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVTGGS
AGASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGEPANGSSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtttggcctccaaagaaacgcggtaatcggactcaacctctactgtgggggggccggc
ttgggggccggcagcggcggcgccacccctccgggagggcggcttttggccacagagaag
gaggcctcggcccagcgagaggtagggggaggggaggccggcgcggtgactggcggaagc
gccggcgctagccccccggccgccctcacgcctgacgcccgaagggtcgtgcggccgccg
cccattggcgccgaggtccccgacgtcaccgcgaccccctcgaggctgctgttcttcgcg
cccacccgccgcgcggcgccgctggaggagatggaagccccggccgccgacgccatcatg
tcgccggaagaagagctggacgggtacgagccggagcctctcgggaagcggccggctgtc
ctgcctctgctggagttggtcggggagcctgctaatggctccagtacggacgggtcacta
ccgtcgacgccgccgccagcagaggaggaggaggacgagttgtaccggcagtcgctggag
attatctctcggtaccttcgggagcaggcgaccggcgccaaggacacaaagccaatgggc
aggtccggggccgccagcaggaaggcgctggagaccttacgacgggttggggacggcgtg
cagcgcaaccacgagacggccttccaaggcatgcttcggaaactggacatcaaaaacgaa
gacgatgtcaaatctttgtctcgagtgatggtccatgttttcagcgacggcgtaacaaac
tggggtaggattgtgactctcatttcttttggtgcctttgtggccaaacacttgaagacc
ataaaccaagaaagctgcattgaaccattagcagaaagtatcacagacgttctcgtaagg
acaaaacgggactggctagttaaacaaagaggctgggatgggtttgtggagttcttccat
gtagaggacctagaaggtggcatcagaaatgtgctgctggcttttgcgggtgttgctgga
gtaggagctgggttggcatatctaataagatag

DBGET integrated database retrieval system